Anti-Occludin antibody [CL1555] (ab242202)

Submit a review Submit a question

Overview

  • Product name

    Anti-Occludin antibody [CL1555]
    See all Occludin primary antibodies

  • Description

    Mouse monoclonal [CL1555] to Occludin

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Dog, Orangutan

  • Immunogen

    Recombinant fragment corresponding to Human Occludin aa 282-415.
    Sequence:

    DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKV NDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRA PAKGRAGRSKRTEQDHYETDYTTGGESCDELEED


    Database link: Q16625

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Epitope

    Binds to an epitope located within the peptide sequence TSPVDDFRQPRYSSG as determined by overlapping synthetic peptides.

  • Positive control

    • WB: Caco-2 cell lysate. ICC/IF: Caco-2 cells. IHC-P: Human stomach cancer, liver, kidney, colon, breast cancer, placenta and prostate cancer tissue.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...

  • Purity

    Protein A purified

  • Purification notes

    Purified from TCS.

  • Clonality

    Monoclonal

  • Clone number

    CL1555

  • Isotype

    IgG2a

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab242202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.
ICC/IF Use a concentration of 2 - 10 µg/ml.

Fixation: PFA/Triton X-100.

Target

  • Function

    May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.

  • Tissue specificity

    Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.

  • Involvement in disease

    Defects in OCLN are the cause of band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]; also known as pseudo-TORCH syndrome. BLCPMG is a neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.

  • Sequence similarities

    Belongs to the ELL/occludin family.
    Contains 1 MARVEL domain.

  • Domain

    The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.

  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR. Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1.

  • Cellular localization

    Membrane. Cell junction > tight junction.
  • Information by UniProt

  • Database links

    • Alternative names

      • BLCPMG antibody
      • FLJ08163 antibody
      • FLJ18079 antibody
      • FLJ77961 antibody
      • FLJ94056 antibody
      • MGC34277 antibody
      • Occludin antibody
      • Ocln antibody
      • OCLN_HUMAN antibody
      • Phosphatase 1 regulatory subunit 115 antibody
      • PPP1R115 antibody
      • PTORCH1 antibody
      • Tight junction protein occludin antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-Occludin antibody [CL1555] (ab242202)
      Immunocytochemistry/ Immunofluorescence - Anti-Occludin antibody [CL1555] (ab242202)

      PFA-fixed, Triton X-100 permeabilized CACO-2 cells stained for OCLN (Green) using ab242202 at 4 μg/ml in ICC/IF.

      Microtublues are stained red, nuclei are stained blue.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Western blot - Anti-Occludin antibody [CL1555] (ab242202)
      Western blot - Anti-Occludin antibody [CL1555] (ab242202)
      All lanes : Anti-Occludin antibody [CL1555] (ab242202) at 1 µg/ml

      Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cell lysate
      Lane 2 : U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) cell lysate

      Predicted band size: 59 kDa

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human placenta tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human colon tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human kidney tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Formalin-fixed, paraffin-embedded human liver tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody [CL1555] (ab242202)

      Negative control: Formalin-fixed, paraffin-embedded human tonsil tissue stained for Occludin with ab242202 at a 1/500 dilution in immunohistochemical analysis.

    References

    ab242202 has not yet been referenced specifically in any publications.

    Publishing research using ab242202? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab242202.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com