Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
Key features and details
- Rabbit polyclonal to Occludin - Neural Stem Cell Marker
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Occludin antibody - Neural Stem Cell Marker
See all Occludin primary antibodies -
Description
Rabbit polyclonal to Occludin - Neural Stem Cell Marker -
Host species
Rabbit -
Tested Applications & Species
Application Species IHC-P HumanWB MouseHuman -
Immunogen
Recombinant full length protein corresponding to Human Occludin aa 1-522.
Sequence:MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLG FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC KQLKSKLSHIKKMVGDYDRQKT
Database link: NP_002529.1 -
Positive control
- Human and Mouse liver lysates; Occludin-transfected 293T cell line lysate This antibody gave a positive result in IHC in the following FFPE tissue: Human normal kidney
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab168986 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
IHC-P |
Human
|
WB |
Mouse
Human
|
All applications |
Rat
Dog
Orangutan
|
Application | Abreviews | Notes |
---|---|---|
WB | (2) |
Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa.
|
IHC-P |
Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 59 kDa. |
IHC-P
Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions. -
Tissue specificity
Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis. -
Involvement in disease
Defects in OCLN are the cause of band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]; also known as pseudo-TORCH syndrome. BLCPMG is a neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay. -
Sequence similarities
Belongs to the ELL/occludin family.
Contains 1 MARVEL domain. -
Domain
The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1. -
Cellular localization
Membrane. Cell junction > tight junction. - Information by UniProt
-
Database links
- Entrez Gene: 403844 Dog
- Entrez Gene: 100506658 Human
- Entrez Gene: 18260 Mouse
- Entrez Gene: 100174190 Orangutan
- Entrez Gene: 83497 Rat
- Omim: 602876 Human
- SwissProt: Q28269 Dog
- SwissProt: Q16625 Human
see all -
Alternative names
- BLCPMG antibody
- FLJ08163 antibody
- FLJ18079 antibody
see all
Images
-
Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml + Human liver lysate at 50 µg
Secondary
Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 59 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
IHC image of Occludin staining in Human normal kidney formalin fixed paraffin embedded tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab168986, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.
For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
*Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre
-
Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml + Mouse liver lysate at 50 µg
Secondary
Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 59 kDa -
All lanes : Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml
Lane 1 : Occludin-transfected 293T cell line lysate
Lane 2 : Non-transfected 293T cell line lysate
Secondary
All lanes : Goat Anti-Rabbit IgG at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 59 kDa
Protocols
References (20)
ab168986 has been referenced in 20 publications.
- Hu X et al. The RNA-binding protein AKAP8 suppresses tumor metastasis by antagonizing EMT-associated alternative splicing. Nat Commun 11:486 (2020). PubMed: 31980632
- Li JM et al. Dietary fructose-induced gut dysbiosis promotes mouse hippocampal neuroinflammation: a benefit of short-chain fatty acids. Microbiome 7:98 (2019). PubMed: 31255176
- Wu Y et al. Silencing of RAD51AP1 suppresses epithelial-mesenchymal transition and metastasis in non-small cell lung cancer. Thorac Cancer 10:1748-1763 (2019). PubMed: 31317661
- Xiang Y et al. USP9X promotes LPS-induced pulmonary epithelial barrier breakdown and hyperpermeability by activating an NF-?Bp65 feedback loop. Am J Physiol Cell Physiol 317:C534-C543 (2019). PubMed: 31216195
- Dong JP et al. Protective effect of Saccharomyces boulardii on intestinal mucosal barrier of dextran sodium sulfate-induced colitis in mice. Chin Med J (Engl) 132:1951-1958 (2019). PubMed: 31335471