Overview

  • Product name

  • Description

    Rabbit polyclonal to OCEL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human OCEL1 aa 1-86. N-terminal His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    MQIHAGPASRRGRRGPLARLSGPEATCNSRPAARGRQRAAAPRMPAPERP RSRRPQSQPGPGELCVKPRKIVFADELRPREPLHPE


    Database link: Q8VCR9

  • Positive control

    • WB: Mouse testis lysate; Recombinant mouse OCEL1 protein. IHC-P: Mouse pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Relevance

    OCEL1 belongs to the ELL/occludin family. The function of this protein has not been specifically defined.
  • Database links

  • Alternative names

    • 9430098E02Rik antibody
    • AI326022 antibody
    • AI5935 antibody
    • FLJ22709 antibody
    • FWP009 antibody
    • MGC189548 antibody
    • Occludin/ELL domain containing 1 antibody
    • Occludin/ELL domain containing protein 1 antibody
    • OTTMUSP00000025081 antibody
    • OTTMUSP00000025082 antibody
    • rCG_38810 antibody
    • rCG38724 antibody
    • RGD1563236 antibody
    • RGD1565407 antibody
    • S863 9 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for OCEL1 using ab233425 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-OCEL1 antibody (ab233425) at 3 µg/ml + Mouse testis lysate

    Predicted band size: 25 kDa

  • Anti-OCEL1 antibody (ab233425) at 2 µg/ml + Recombinant mouse OCEL1 protein

    Predicted band size: 25 kDa

References

ab233425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up