Overview

  • Product name

    Anti-OCM antibody
  • Description

    Rabbit polyclonal to OCM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human OCM aa 1-41.
    Sequence:

    MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA

  • Positive control

    • Human pancreas tissue.
  • General notes

     This product was previously labelled as oncomodulin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab150947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human pancreas tissue labeling OCM with ab150947 at a 1/50 dilution.

References

ab150947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Ventana Cell Conditioning Buffer 1
Sample
Mouse Tissue sections (Inner ear, 4 days old.)
Specification
Inner ear, 4 days old.
Permeabilization
No
Fixative
Formaldehyde

Morag Lewis

Verified customer

Submitted Aug 26 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up