Anti-OCM antibody (ab150947)
Key features and details
- Rabbit polyclonal to OCM
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-OCM antibody -
Description
Rabbit polyclonal to OCM -
Host species
Rabbit -
Tested Applications & Species
Application Species IHC-P Human -
Immunogen
Recombinant fragment corresponding to Human OCM aa 1-41.
Sequence:MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
-
Positive control
- IHC-P: Human testis and cerebellum tissues.
-
General notes
This product was previously labelled as oncomodulin
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab150947 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
IHC-P |
Human
|
All applications |
Mouse
Rat
|
Application | Abreviews | Notes |
---|---|---|
IHC-P | (1) |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. -
Sequence similarities
Belongs to the parvalbumin family.
Contains 2 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 654231 Human
- Entrez Gene: 18261 Mouse
- Entrez Gene: 25503 Rat
- Omim: 164795 Human
- SwissProt: P0CE72 Human
- SwissProt: P51879 Mouse
- SwissProt: P02631 Rat
- Unigene: 571315 Human
see all -
Alternative names
- Ocm antibody
- OCMN antibody
- OM antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling OCM with ab150947 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebellum tissue labelling OCM with ab150947 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling OCM with ab150947 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
Datasheets and documents
References (0)
ab150947 has not yet been referenced specifically in any publications.