Anti-Oct-1 antibody (ab167483)
Key features and details
- Mouse polyclonal to Oct-1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Oct-1 antibody
See all Oct-1 primary antibodies -
Description
Mouse polyclonal to Oct-1 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig -
Immunogen
Full length protein corresponding to Human Oct-1 aa 1-743.
Sequence:MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGH LHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQT QLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAG ATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTN LQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPA TPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLE NQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPI KAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVTNLSVTGTSDT TSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTS TPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPI TSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ
Database link: P14859 -
Positive control
- Recombinant Human Oct-1 protein (ab152623) can be used as a positive control in WB. HeLa cells; Oct-1 transfected 293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab167483 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa. | |
ICC/IF | Use a concentration of 10 µg/ml. |
Target
-
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes. -
Tissue specificity
Ubiquitous. Isoform 2 is lymphocyte-specific. -
Sequence similarities
Belongs to the POU transcription factor family. Class-2 subfamily.
Contains 1 homeobox DNA-binding domain.
Contains 1 POU-specific domain. -
Post-translational
modificationsPhosphorylated by PRKDC. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 512840 Cow
- Entrez Gene: 490360 Dog
- Entrez Gene: 5451 Human
- Entrez Gene: 18986 Mouse
- Entrez Gene: 397501 Pig
- Entrez Gene: 171068 Rat
- Omim: 164175 Human
- SwissProt: P15143 Chicken
see all -
Alternative names
- FLJ42836 antibody
- NF A1 antibody
- NF-A1 antibody
see all
Images
-
Immunofluorescent analysis of HeLa cells labeling Oct-1 with ab167483 at 10 µg/ml.
-
All lanes : Anti-Oct-1 antibody (ab167483) at 1 µg/ml
Lane 1 : Oct-1 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Predicted band size: 76 kDa
Protocols
Datasheets and documents
References (0)
ab167483 has not yet been referenced specifically in any publications.