For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    oct-1-antibody-ab167483.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families Developmental Families OCT
Share by email

Anti-Oct-1 antibody (ab167483)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-Oct-1 antibody (ab167483)
  • Western blot - Anti-Oct-1 antibody (ab167483)

Key features and details

  • Mouse polyclonal to Oct-1
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-Oct-1 antibody
    See all Oct-1 primary antibodies
  • Description

    Mouse polyclonal to Oct-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig
  • Immunogen

    Full length protein corresponding to Human Oct-1 aa 1-743.
    Sequence:

    MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGH LHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQT QLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAG ATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTN LQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPA TPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLE NQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPI KAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVTNLSVTGTSDT TSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTS TPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPI TSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ


    Database link: P14859
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Recombinant Human Oct-1 protein (ab152623) can be used as a positive control in WB. HeLa cells; Oct-1 transfected 293T cell lysate.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Developmental Families
    • OCT

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)

Applications

Our Abpromise guarantee covers the use of ab167483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 76 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
  • Tissue specificity

    Ubiquitous. Isoform 2 is lymphocyte-specific.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Post-translational
    modifications

    Phosphorylated by PRKDC.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession P14859 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 512840 Cow
    • Entrez Gene: 490360 Dog
    • Entrez Gene: 5451 Human
    • Entrez Gene: 18986 Mouse
    • Entrez Gene: 397501 Pig
    • Entrez Gene: 171068 Rat
    • Omim: 164175 Human
    • SwissProt: P15143 Chicken
    • SwissProt: P14859 Human
    • SwissProt: P25425 Mouse
    • SwissProt: Q29076 Pig
    • SwissProt: P31503 Rat
    • Unigene: 283402 Human
    • Unigene: 245261 Mouse
    • Unigene: 46306 Rat
    see all
  • Alternative names

    • FLJ42836 antibody
    • NF A1 antibody
    • NF-A1 antibody
    • Oct 1 antibody
    • Oct 1B antibody
    • Oct-1 antibody
    • OCT1 antibody
    • Octamer binding protein 1 antibody
    • Octamer binding transcription factor 1 antibody
    • Octamer-binding protein 1 antibody
    • Octamer-binding transcription factor 1 antibody
    • OTF 1 antibody
    • OTF-1 antibody
    • OTF1 antibody
    • OTTHUMP00000032348 antibody
    • OTTHUMP00000032350 antibody
    • OTTHUMP00000032351 antibody
    • PO21 antibody
    • PO2F1 antibody
    • PO2F1_HUMAN antibody
    • POU class 2 homeobox 1 antibody
    • POU domain class 2 transcription factor 1 antibody
    • POU domain, class 2, transcription factor 1 antibody
    • POU2F1 antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Oct-1 antibody (ab167483)
    Immunocytochemistry/ Immunofluorescence - Anti-Oct-1 antibody (ab167483)

    Immunofluorescent analysis of HeLa cells labeling Oct-1 with ab167483 at 10 µg/ml.

  • Western blot - Anti-Oct-1 antibody (ab167483)
    Western blot - Anti-Oct-1 antibody (ab167483)
    All lanes : Anti-Oct-1 antibody (ab167483) at 1 µg/ml

    Lane 1 : Oct-1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 76 kDa

Protocols

  • Western blot protocols
  • Immunocytochemistry & immunofluorescence protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab167483? Please let us know so that we can cite the reference in this datasheet.

    ab167483 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab167483.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.