Overview

  • Product name

  • Description

    Rabbit polyclonal to Oct-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chicken, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human Oct-1 aa 15-290.
    Sequence:

    GDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAA AQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTL TPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQI PLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQG QQGLLQAQNLLTQLPQ


    Database link: P14859

  • Positive control

    • HeLa, HL-60, K562, Jurkat, Raji and mouse craniofacial cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 76 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
  • Tissue specificity

    Ubiquitous. Isoform 2 is lymphocyte-specific.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Post-translational
    modifications

    Phosphorylated by PRKDC.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ42836 antibody
    • NF A1 antibody
    • NF-A1 antibody
    • Oct 1 antibody
    • Oct 1B antibody
    • Oct-1 antibody
    • OCT1 antibody
    • Octamer binding protein 1 antibody
    • Octamer binding transcription factor 1 antibody
    • Octamer-binding protein 1 antibody
    • Octamer-binding transcription factor 1 antibody
    • OTF 1 antibody
    • OTF-1 antibody
    • OTF1 antibody
    • OTTHUMP00000032348 antibody
    • OTTHUMP00000032350 antibody
    • OTTHUMP00000032351 antibody
    • PO21 antibody
    • PO2F1 antibody
    • PO2F1_HUMAN antibody
    • POU class 2 homeobox 1 antibody
    • POU domain class 2 transcription factor 1 antibody
    • POU domain, class 2, transcription factor 1 antibody
    • POU2F1 antibody
    see all

Images

  • Anti-Oct-1 antibody (ab180749) at 1/500 dilution + HeLa cell lysate

    Predicted band size: 76 kDa

  • All lanes : Anti-Oct-1 antibody (ab180749) at 1/500 dilution

    Lane 1 : HL-60 cell lysate
    Lane 2 : K562 cell lysate
    Lane 3 : HeLa cell lysate
    Lane 4 : Jurkat cell lysate
    Lane 5 : Raji cell lysate
    Lane 6 : Mouse craniofacial cell lysate

    Predicted band size: 76 kDa

References

ab180749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Bos taurus Cell lysate - whole cell (Madin Darby Bovine Kidney cells)
Gel Running Conditions
Reduced Denaturing (4-15% TGX gel (Biorad))
Loading amount
20 µg
Specification
Madin Darby Bovine Kidney cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 18°C

Abcam user community

Verified customer

Submitted Jun 24 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up