Overview

  • Product name

  • Description

    Rabbit polyclonal to OFD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human OFD1 aa 598-771.
    Sequence:

    NVLARMVASRITNYPTAWVEGSSPDSDLEFVANTKARVKELQQEAERLEK AFRSYHRRVIKNSAKSPLAAKSPPSLHLLEAFKNITSSSPERHIFGEDRV VSEQPQVGTLEERNDVVEALTGSAASRLRGGTSSRRLSSTPLPKAKRSLE SEMYLEGLGRSHIASPSPCPDRMP


    Database link: O75665

  • Positive control

    • WB: Mouse skeletal muscle tissue lysate. IHC-P: Human adrenal gland tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 117 kDa (predicted molecular weight: 43,112,117 kDa).

Target

  • Function

    Component of the centrioles controlling mother and daughter centrioles length. Recruits to the centriole IFT88 and centriole distal appendage-specific proteins including CEP164. Involved in the biogenesis of the cilium, a centriole-associated function. The cilium is a cell surface projection found in many vertebrate cells required to transduce signals important for development and tissue homeostasis. Plays an important role in development by regulating Wnt signaling and the specification of the left-right axis. Only OFD1 localized at the centriolar satellites is removed by autophagy, which is an important step in the ciliogenesis regulation.
  • Tissue specificity

    Widely expressed. Expressed in 9 and 14 weeks old embryos in metanephric mesenchyme, oral mucosa, lung, heart, nasal and cranial cartilage, and brain. Expressed in metanephros, brain, tongue, and limb.
  • Involvement in disease

    Orofaciodigital syndrome 1
    Simpson-Golabi-Behmel syndrome 2
    Joubert syndrome 10
    Retinitis pigmentosa 23
  • Sequence similarities

    Belongs to the OFD1 family.
    Contains 1 LisH domain.
  • Cellular localization

    Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Localizes to centriole distal ends and to centriolar satellites (PubMed:20230748, PubMed:24121310).
  • Information by UniProt
  • Database links

  • Alternative names

    • 71 7A antibody
    • 717A antibody
    • CXorf5 antibody
    • JBTS10 antibody
    • Ofd1 antibody
    • OFD1_HUMAN antibody
    • oral facial digital syndrome 1 antibody
    • Oral-facial-digital syndrome 1 protein antibody
    • OTTHUMP00000022941 antibody
    • Protein 71-7A antibody
    • RGD1562231 antibody
    • SGBS2 antibody
    see all

Images

  • Anti-OFD1 antibody (ab222837) at 1/500 dilution + Mouse skeletal muscle tissue lysate

    Secondary
    Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43,112,117 kDa
    Observed band size: 117 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for OFD1 (green) using ab222837 at 1/100 dilution in ICC/IF. Alexa Fluor 488-congugated Goat Anti-Rabbit IgG(H+L) was used as secondary antibody.

  • Paraffin-embedded human adrenal gland tissue stained for OFD1 using ab222837 at 1/100 dilution in immunohistochemical analysis.

References

ab222837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up