Overview

  • Product name

    Anti-OGFOD1/TPA1 antibody
  • Description

    Rabbit polyclonal to OGFOD1/TPA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human OGFOD1/TPA1 aa 398-538.
    Sequence:

    EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHY TLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPES NSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSF


    Database link: Q8N543

  • Positive control

    • ICC/IF: U-251 MG cells. WB: SK-BR-3, NIH/3T3 and NBT-II cell lysate. IHC-P: Mouse midbrain, hippocampus and cerebellum tissue. Human cerebral cortex and cerebellum tissue. Human testis tissue.
  • General notes

     This product was previously labelled as OGFOD1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 63 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • Paraffin embedded mouse cerebellum tissue stained for OGFOD1/TPA1 with ab224056 (1/200 dilution) in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for OGFOD1/TPA1 (green) using ab224056 (4 µg/ml) in ICC/IF.

  • Anti-OGFOD1/TPA1 antibody (ab224056) at 1/100 dilution + SK-BR-3 (human mammary gland adenocarcinoma cell line) cell lysate

    Predicted band size: 63 kDa

  • Paraffin embedded human cerebellum tissue stained for OGFOD1/TPA1 with ab224056 (1/200 dilution) in immunohistochemical analysis.

  • Anti-OGFOD1/TPA1 antibody (ab224056) at 1/100 dilution + human cerebral cortex tissue lysate

    Predicted band size: 63 kDa

  • All lanes : Anti-OGFOD1/TPA1 antibody (ab224056) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat cell line) cell lysate

    Predicted band size: 63 kDa

  • Paraffin embedded mouse midbrain tissue stained for OGFOD1/TPA1 with ab224056 (1/200 dilution) in immunohistochemical analysis.

  • Paraffin embedded mouse hippocampus tissue stained for OGFOD1/TPA1 with ab224056 (1/200 dilution) in immunohistochemical analysis.

  • Paraffin embedded human cerebral cortex tissue stained for OGFOD1/TPA1 with ab224056 (1/200 dilution) in immunohistochemical analysis.

  • Paraffin embedded human testis tissue stained for OGFOD1/TPA1 with ab224056 (1/200 dilution) in immunohistochemical analysis.

References

ab224056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up