Overview

  • Product name

  • Description

    Rabbit polyclonal to OGFr
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human OGFr aa 1-280.
    Sequence:

    MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRA ARPSSFQSRMTGSRNWRATRDMCRYRHNYPDLVERDCNGDTPNLSFYRNE IRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREPGVNWHAKPLT LREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRF QNLNWRSHNNLRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVR QSALDYFMFAVRCRHQRRQLVHFAWEHFRP


    Database link: Q9NZT2

  • Positive control

    • IHC-P: Human skeletal muscle and colon cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Receptor for opioid growth factor (OGF), also known as Met-enkephalin. Seems to be involved in growth regulation.
  • Tissue specificity

    Highly expressed in the heart and liver, moderately in skeletal muscle and kidney and to a lesser extent in brain and pancreas. Expressed in fetal tissues including liver and kidney.
  • Sequence similarities

    Belongs to the opioid growth factor receptor family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus. The OGF/OGFR complex is probably translocated to the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 7 60 protein antibody
    • HGNC:15768 antibody
    • Met enkephalin receptor antibody
    • OGFr antibody
    • OGFR_HUMAN antibody
    • Opioid growth factor receptor antibody
    • Protein 7-60 antibody
    • Zeta Opioid Receptor antibody
    • Zeta type opioid receptor antibody
    • Zeta-type opioid receptor antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for OGFr using ab229664 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for OGFr using ab229664 at 1/100 dilution in immunohistochemical analysis.

References

ab229664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up