Overview

  • Product name

  • Description

    Rabbit polyclonal to Ogg1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Ogg1 aa 31-345. (Expressed in E.coli).
    Sequence:

    SELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRG DKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGV RLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRE SSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQ EPPAKRRKGSKGPEG


    Database link: O15527

  • Positive control

    • WB: Pig heart and kidney lysate; Recombinant human Ogg1 protein. IHC-P: Human brain and liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 39 kDa.

Target

  • Function

    DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in OGG1 may be a cause of renal cell carcinoma (RCC) [MIM:144700]. It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma.
  • Sequence similarities

    Belongs to the type-1 OGG1 family.
  • Cellular localization

    Mitochondrion; Nucleus and Nucleus > nucleoplasm. Nucleus speckle. Nucleus matrix. Together with APEX1 is recruited to nuclear speckles in UVA-irradiated cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • 8 hydroxyguanine DNA glycosylase antibody
    • 8 oxoguanine DNA glycosylase 1 antibody
    • 8 oxoguanine DNA glycosylase antibody
    • AP lyase antibody
    • DNA (apurinic or apyrimidinic site) lyase antibody
    • DNA apurinic or apyrimidinic site lyase antibody
    • DNA lyase antibody
    • DNA-(apurinic or apyrimidinic site) lyase antibody
    • HMMH antibody
    • HOGG 1 antibody
    • HOGG1 antibody
    • MMH antibody
    • MUTM antibody
    • N glycosylase antibody
    • Ogg 1 antibody
    • Ogg1 antibody
    • OGG1_HUMAN antibody
    • OGH 1 antibody
    • OGH1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Ogg1 using ab233214 at 30 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human brain tissue stained for Ogg1 using ab233214 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Ogg1 antibody (ab233214) at 2 µg/ml

    Lane 1 : Pig heart lysate
    Lane 2 : Pig kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 39 kDa

  • Anti-Ogg1 antibody (ab233214) at 2 µg/ml + Recombinant human Ogg1 protein

    Predicted band size: 39 kDa

References

ab233214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up