Overview

  • Product name

    Olfr110 peptide

Description

  • Nature

    Synthetic
  • Amino Acid Sequence
    • Sequence

      RPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQP
    • Amino acids

      261 to 310

Associated products

Specifications

Our Abpromise guarantee covers the use of ab208292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-Olfr110 antibody - C-terminal (ab177327)

  • Form

    Lyophilised
  • Additional notes

    This is the blocking peptide for ab177327

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

  • Reconstitution
    Reconstitute with 100uL sterile PBS

General Info

  • Alternative names

    • Olfactory receptor 110
    • Olfr110 olfactory receptor 110

References

ab208292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up