Overview

  • Product name

    Anti-Oligodendrocyte myelin glycoprotein antibody
    See all Oligodendrocyte myelin glycoprotein primary antibodies
  • Description

    Rabbit polyclonal to Oligodendrocyte myelin glycoprotein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Oligodendrocyte myelin glycoprotein aa 49-157.
    Sequence:

    LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLP RSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSL EVLNLSSNK


    Database link: P23515

  • Positive control

    • IHC: Human cerebral cortex tissue. ICC: U-251 MG sp cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human cerebral cortex tissue stained for Oligodendrocyte myelin glycoprotein using ab224254 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-Oligodendrocyte myelin glycoprotein antibody (ab224254) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

References

ab224254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up