For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    omega-agatoxin-iva-ca2-channel-blocker-p-and-q-type-ab120210.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Biochemicals Product Range Just Add Water
Share by email

omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)

  • Datasheet
  • SDS
  • COA
Submit a review Q&A (1)References (6)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Chemical Structure - omega-Agatoxin IVA, Ca<sup>2+</sup> channel blocker (P and Q type) (ab120210)
  • Functional Studies - omega-Agatoxin IVA, Ca<sup>2+</sup> channel blocker (P and Q type) (ab120210)

Key features and details

  • Ca2+ channel blocker (P and Q type)
  • CAS Number: 145017-83-0
  • Soluble in water to 1mg/ml
  • Form / State: Solid
  • Source: Synthetic

You may also be interested in

Biochemical
Product image
D-AP5, NMDA glutamate site antagonist (ab120003)
Primary
Product image
Anti-C2 antibody [EPR17979] (ab209900)
Protein
Recombinant human IL-13 protein (ab9577)

View more associated products

Overview

  • Product name

    omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type)
  • Description

    Ca2+ channel blocker (P and Q type)
  • Biological description

    Synthetic peptide, originally isolated from Agelenopsis aperta spider venom. Selective blocker of Cav2.1 (P/Q type) channels.

  • CAS Number

    145017-83-0
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    5202.25
  • Molecular formula

    C217H360N68O60S10
  • Sequence

    KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA (Modifications: Disulfide bonds: 4-20, 12-25, 19-36, 27-34)
  • PubChem identifier

    56841669
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water to 1mg/ml
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

    • Biochemicals
    • Product Range
    • Just Add Water
    • Biochemicals
    • Chemical Type
    • Biochemicals
    • Biochemicals
    • Chemical Type
    • Toxin
    • Biochemicals
    • Chemical Type
    • Bioactive peptides
    • Biochemicals
    • Pharmacology
    • Ion Channels
    • Calcium
    • Blockers
    • Biochemicals
    • Pharmacology
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Heart disease
    • Calcium
    • Biochemicals
    • Research Area
    • Heart disease
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Pain & inflammation
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Alzheimer's Disease
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Diabetes
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Diabetes
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Heart disease
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Hypertension
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Hypertension
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Obesity
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Obesity
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Pain & inflammation
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Respiratory disease
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Respiratory disease
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Stroke
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Stroke
    • Signaling
    • Ca2+ signaling
    • Cav channels
    • Biochemicals
    • Research Area
    • Cancer
    • Ca2+ signaling
    • Cav channels

Images

  • Chemical Structure - omega-Agatoxin IVA, Ca<sup>2+</sup> channel blocker (P and Q type) (ab120210)
    Chemical Structure - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)
    2D chemical structure image of ab120210, omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type)
  • Functional Studies - omega-Agatoxin IVA, Ca<sup>2+</sup> channel blocker (P and Q type) (ab120210)
    Functional Studies - omega-Agatoxin IVA, Ca2+ channel blocker (P and Q type) (ab120210)Sargoy et al PLoS One. 2014; 9(1): e84507. Reproduced under the Creative Commons license https://creativecommons.org/publicdomain/zero/1.0/

    Many VGCC subtypes contribute to calcium signalling in ganglion cell bodies.

    Summary of Ca2+ imaging results in RGC somata showing the following changes in paired pulse Ca2+ signal in response to drugs (applied during the second K+ pulse) compared to their control paired K+ pulses (K): 10 µM nifedipine (29%±7%; p = 0.0003; n = 20), 100 µM verapamil (VPM; 39%±5%; p<0.0001; n = 17), 400 nM ω-agatoxin IVA (AGT; 35%±14%; p = 0.0364; n = 9), 3 µM ω-conotoxin-GVIA (CTX; 23%±10%; p = 0.0423; n = 15), 3 µM mibefradil (MIB; 21%±6%; p = 0.0011; n = 16) and 200 nM TTX (40%±9%; p = 0.0004; n = 14).

    (From Figure 7C of Sargoy et al).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download
  • COA

References (6)

Publishing research using ab120210? Please let us know so that we can cite the reference in this datasheet.

ab120210 has been referenced in 6 publications.

  • Prigge CL  et al. M1 ipRGCs Influence Visual Function through Retrograde Signaling in the Retina. J Neurosci 36:7184-97 (2016). PubMed: 27383593
  • Toft-Bertelsen TL  et al. Regulation of Ca2+ channels by SNAP-25 via recruitment of syntaxin-1 from plasma membrane clusters. Mol Biol Cell 27:3329-3341 (2016). PubMed: 27605709
  • Sargoy A  et al. Differential calcium signaling mediated by voltage-gated calcium channels in rat retinal ganglion cells and their unmyelinated axons. PLoS One 9:e84507 (2014). PubMed: 24416240
  • Vilar B  et al. Alleviating pain hypersensitivity through activation of type 4 metabotropic glutamate receptor. J Neurosci 33:18951-65 (2013). PubMed: 24285900
  • Tozer AJ  et al. Nitric oxide signalling augments neuronal voltage-gated L-type (Ca(v)1) and P/q-type (Ca(v)2.1) channels in the mouse medial nucleus of the trapezoid body. PLoS One 7:e32256 (2012). PubMed: 22389692
  • Wang M  et al. Acute restraint stress enhances hippocampal endocannabinoid function via glucocorticoid receptor activation. J Psychopharmacol 26:56-70 (2012). PubMed: 21890595

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question

Is this peptide properly folded?

Read More

Abcam community

Verified customer

Asked on Mar 21 2014

Answer

Our peptides structure is governed primarily by the disulphide bridges in the molecule. These disulphide bridges are in the correct place for ω-Agatoxin IVA and the amino acid sequence is correct.

Read More

Jeremy Kasanov

Abcam Scientific Support

Answered on Mar 21 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.