omega-Agatoxin TK, CaV2.1 P/Q-type calcium channel blocker (ab141780)

Overview

  • Product name

    omega-Agatoxin TK, CaV2.1 P/Q-type calcium channel blocker
  • Description

    Potent, selective CaV2.1 P/Q-type calcium channel blocker
  • Biological description

    Potent, selective CaV2.1 P/Q-type calcium channel blocker (Kd = 3 nM, P-type). Inhibits the high K+ depolarisation-induced rise in internal Ca2+ in nerve endings (IC50 = 60 nM) .
  • Purity

    > 99%
  • CAS Number

    158484-42-5
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    5273.00
  • Molecular formula

    C215H337N65O70S10
  • Sequence

    EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Ser-46 = D-Ser; Disulfide bonds: 4-20, 12-25, 19-36, 27-34)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Wagner-Britz L  et al. Protein Kinase Ca and P-Type Ca Channel CaV2.1 in Red Blood Cell Calcium Signalling. Cell Physiol Biochem 31:883-91 (2013). Read more (PubMed: 23817128) »
  • Sitges M & Galindo CA Omega-agatoxin-TK is a useful tool to study P-type Ca2+ channel-mediated changes in internal Ca2+ and glutamate release in depolarised brain nerve terminals. Neurochem Int 46:53-60 (2005). Read more (PubMed: 15567515) »
  • Adams ME  et al. Structure and properties of omega-agatoxin IVB, a new antagonist of P-type calcium channels. Mol Pharmacol 44:681-8 (1993). Read more (PubMed: 8232218) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up