Overview

  • Product name

  • Description

    Rabbit polyclonal to OP-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human OP-2 aa 253-302.
    Sequence:

    RASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCR


    Database link: P34820

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: A549 cells. WB: COLO cell extract.
  • General notes

    Protein previously labeled as BMP8b.

Properties

Applications

Our Abpromise guarantee covers the use of ab230553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 45 kDa.
IHC-P 1/50.
ICC/IF 1/100 - 1/500.

Target

  • Function

    Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMP-8 antibody
    • BMP-8B antibody
    • BMP8 antibody
    • Bmp8b antibody
    • BMP8B_HUMAN antibody
    • bone morphogenetic protein 8 (osteogenic protein 2) antibody
    • Bone morphogenetic protein 8 antibody
    • Bone morphogenetic protein 8B antibody
    • dJ118J21.1 (bone morphogenetic protein 8 (osteogenic protein 2)) antibody
    • OP-2 antibody
    • OP2 antibody
    • Osteogenic protein 2 antibody
    see all

Images

  • All lanes : Anti-OP-2 antibody (ab230553) at 1/500 dilution

    Lane 1 : COLO 205 (Human colon adenocarcinoma cell line) whole cell lysate
    Lane 2 : COLO 205 (Human colon adenocarcinoma cell line) whole cell lysate with Immunizing peptide

    Predicted band size: 45 kDa

  • Immunofluourescence analysis of A549 (human lung carcinoma cell line) cells stained for OP-2 using ab230553 at 1/100 dilution. The image on the right is treated with the immunizing peptide.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for OP-2 using ab230553 at 1/50 dilution in immunohistochemical analysis.

References

ab230553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up