Overview

  • Product name

    Anti-OPA1L antibody [OPAL1-01] (Phycoerythrin)
    See all OPA1L primary antibodies
  • Description

    Mouse monoclonal [OPAL1-01] to OPA1L (Phycoerythrin)
  • Host species

    Mouse
  • Conjugation

    Phycoerythrin. Ex: 488nm, Em: 575nm
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human OPA1L aa 152-342.
    Sequence:

    GSQGAQSSPLSEPSRSSTRPPSIADPDPSDLPVDRAATKAPGMEPSGSVA GLGELDPGAFLDKDAECREELLKDDSSEHGAPDSKEKTPGRHRRFTGDSG IEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPGDEEEGLCQ SSEEQAREPGHPHLPRPPACLLLNTINEQDSPNSQSSSSPS


    Database link: Q9NX94

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer

    Preservative: 0.097% Sodium azide
    Constituents: 99% PBS, 0.2% BSA
  • Concentration information loading...
  • Purity

    Size exclusion
  • Purification notes

    Purified antibody is conjugated with R-Phycoerythrin (PE) under optimum conditions. The conjugate was purified by size-exclusion chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OPAL1-01
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use at an assay dependent concentration.

Target

References

ab191109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up