Overview

  • Product name

  • Description

    Rabbit polyclonal to OPA3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human OPA3 aa 23-179. (Expressed in E.coli).
    Sequence:

    LANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLN EEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNAL RDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASH AVPASKK


    Database link: Q9H6K4

  • Positive control

    • WB: Recombinant human OPA3; Jurkat cell lysate; Pig kidney and skeletal muscle lysates. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231328 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Relevance

    OPA3 may play some role in mitochondrial processes. Defects in OPA3 are the cause of 3-methylglutaconic aciduria type 3 (MGA3), also known as optic atrophy plus syndrome, and of optic atrophy type 3 (OPA3), also known as autosomal dominant optic atrophy and cataract (ADOAC).
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • FLJ22187 antibody
    • FLJ25932 antibody
    • Iraqi Jewish optic atrophy plus (3 methylglutaconicaciduria type 3) antibody
    • MGA3 antibody
    • MGC75494 antibody
    • OPA 3 antibody
    • OPA3 protein antibody
    • Optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) antibody
    • Optic atrophy 3 (Iraqi Jewish 'optic atrophy plus') antibody
    • Optic atrophy 3 antibody
    • Optic atrophy 3 protein antibody
    see all

Images

  • Anti-OPA3 antibody (ab231328) at 2 µg/ml + Recombinant human OPA3 protein

    Predicted band size: 20 kDa

  • Anti-OPA3 antibody (ab231328) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 20 kDa

  • Anti-OPA3 antibody (ab231328) at 2 µg/ml + Pig kidney lysate

    Predicted band size: 20 kDa

  • Anti-OPA3 antibody (ab231328) at 2 µg/ml + Pig skeletal muscle lysate

    Predicted band size: 20 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for OPA3 using ab231328 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up