Overview

  • Product name

    Anti-OR10C1 antibody - C-terminal
  • Description

    Rabbit polyclonal to OR10C1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Dog
  • Immunogen

    Synthetic peptide within Human OR10C1 aa 170-219 (C terminal). The exact sequence is proprietary.
    Sequence:

    PNTIPQFFCEIQPVLQLVCGDTSLNELQIILATALLILCPFGLILGSYGR


    Database link: Q96KK4

  • Positive control

    • Jurkat whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes.
  • Cellular localization

    Cell membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • hs6M1 17 antibody
    • Olfactory receptor 10C1 antibody
    • Olfactory receptor 10C2 antibody
    • Olfactory receptor family 10 subfamily C member 1 antibody
    • Olfactory receptor family 10 subfamily C member 2 antibody
    • Olfactory receptor OR6 31 antibody
    • OR10C1P antibody
    • OR10C2 antibody
    • OR6 31 antibody
    • Seven transmembrane helix receptor antibody
    see all

Images

  • Anti-OR10C1 antibody - C-terminal (ab182513) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 34 kDa

References

ab182513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up