Overview

  • Product name

    Anti-OR10K2 antibody - C-terminal
  • Description

    Rabbit polyclonal to OR10K2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human OR10K2 aa 242-291 (C terminal). The exact sequence is proprietary. (NP_001004476)
    Sequence:

    VSHLIIVTVHYGCASFIYLRPQSNYSSSQDALISVSYTIITPLFNPMIYS


    Database link: Q6IF99

  • Positive control

    • Human fetal kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function

    Odorant receptor.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • O10K2_HUMAN antibody
    • Olfactory receptor 10K2 antibody
    • Olfactory receptor OR1-4 antibody
    • olfactory receptor, family 10, subfamily K, member 2 antibody
    • OR1-4 antibody
    • OR10K2 antibody
    see all

Images

  • Anti-OR10K2 antibody - C-terminal (ab182488) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Predicted band size: 35 kDa

References

ab182488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up