Overview

  • Product name

    Anti-OR5B3 antibody - C-terminal
  • Description

    Rabbit polyclonal to OR5B3 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human OR5B3 aa 261-310 (C terminal). The exact sequence is proprietary.
    Sequence:

    SSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFKKVVEKAKLSV


    Database link: Q8NH48

  • Positive control

    • COLO205 whole cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab186624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 34 kDa (predicted molecular weight: 35 kDa).

Target

  • Function

    Odorant receptor.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Olfactory receptor 5B13 antibody
    • Olfactory receptor 5B3 antibody
    • Olfactory receptor OR11-239 antibody
    • Olfactory receptor, family 5, subfamily B, member 3 antibody
    • OR11 239 antibody
    • OR5B13 antibody
    • OR5B3 antibody
    • OR5B3_HUMAN antibody
    • OST129 antibody
    • OTTHUMP00000236079 antibody
    see all

Images

References

ab186624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up