Overview

  • Product name

  • Description

    Rabbit polyclonal to Orai1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Orai1 aa 197-234.
    Sequence:

    VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA


    Database link: Q96D31

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores and channel activation by the Ca(2+) sensor, STIM1. CRAC channels are the main pathway for Ca(2+) influx in T-cells and promote the immune response to pathogens by activating the transcription factor NFAT.
  • Involvement in disease

    Defects in ORAI1 are the cause of immune dysfunction with T-cell inactivation due to calcium entry defect type 1 (IDTICED1) [MIM:612782]. IDTICED1 is an immune disorder characterized by recurrent infections, impaired T-cell activation and proliferative response, decreased T-cell production of cytokines, and normal lymphocytes counts and serum immunoglobulin levels. In surviving patients ectodermal dysplasia with anhydrosis and non-progressive myopathy may be observed.
  • Sequence similarities

    Belongs to the Orai family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calcium release activated calcium channel protein 1 antibody
    • Calcium release activated calcium modulator 1 antibody
    • Calcium release-activated calcium channel protein 1 antibody
    • CRACM 1 antibody
    • CRACM1 antibody
    • CRCM1 antibody
    • CRCM1_HUMAN antibody
    • FLJ14466 antibody
    • Orai 1 antibody
    • ORAI calcium release activated calcium modulator 1 antibody
    • orai1 antibody
    • ORAT1 antibody
    • Protein orai 1 antibody
    • Protein orai-1 antibody
    • TMEM 142A antibody
    • TMEM142A antibody
    • Transmembrane protein 142A antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Orai1 (green) using ab244520 at 4 µg/ml in ICC/IF.

References

ab244520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up