Overview

  • Product name

  • Description

    Rabbit polyclonal to ORC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ORC2 aa 11-108.
    Sequence:

    MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEED DQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK


    Database link: Q13416

  • Positive control

    • WB: RT4 and U-251 MG cell lysates.. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 66 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Sequence similarities

    Belongs to the ORC2 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • orc2 antibody
    • ORC2_HUMAN antibody
    • ORC2L antibody
    • Origin of replication 2 (yeast homolog) like antibody
    • Origin recognition complex protein 2 homolog antibody
    • Origin recognition complex subunit 2 antibody
    • Origin recognition complex subunit 2 isoform B antibody
    • Origin recognition complex subunit 2 like (yeast) antibody
    • Origin recognition complex, subunit 2 homolog antibody
    • Origin recognition complex, subunit 2, S. cerevisiae, homolog of antibody
    • Origin recognition complex, subunit 2-like (S. cerevisiae) antibody
    see all

Images

  • All lanes : Anti-ORC2 antibody (ab221962) at 1/250 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 66 kDa

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver cancer cell line) cells stained for ORC2 (green) using ab221962 at 4 ug/ml in ICC/IF.

References

ab221962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up