Overview

  • Product name

  • Description

    Rabbit polyclonal to ORC4L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ORC4L aa 187-436.
    Sequence:

    IAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSL PAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLA LNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLN DIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIK PMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL


    Database link: O43929

  • Positive control

    • WB: HeLa, Jurkat and A549 whole cell lysates. IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 50 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Involvement in disease

    Defects in ORC4 are the cause of Meier-Gorlin syndrome type 2 (MGORS2) [MIM:613800]. MGORS2 is a syndrome characterized by bilateral microtia, aplasia/hypoplasia of the patellae, and severe intrauterine and postnatal growth retardation with short stature and poor weight gain. Additional clinical findings include anomalies of cranial sutures, microcephaly, apparently low-set and simple ears, microstomia, full lips, highly arched or cleft palate, micrognathia, genitourinary tract anomalies, and various skeletal anomalies. While almost all cases have primordial dwarfism with substantial prenatal and postnatal growth retardation, not all cases have microcephaly, and microtia and absent/hypoplastic patella are absent in some. Despite the presence of microcephaly, intellect is usually normal.
  • Sequence similarities

    Belongs to the ORC4 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Origin recognition complex, subunit 4, S. cerevisiae, homolog of antibody
    • FLJ46668 antibody
    • HSORC4 antibody
    • ORC 4 antibody
    • ORC 4L antibody
    • ORC 4P antibody
    • ORC4 antibody
    • ORC4_HUMAN antibody
    • ORC4L antibody
    • ORC4L protein antibody
    • ORC4P antibody
    • Origin recognition complex subunit 4 (yeast homolog) like antibody
    • Origin recognition complex subunit 4 antibody
    • Origin recognition complex subunit 4 like (yeast) antibody
    • Origin recognition complex subunit 4 like antibody
    • origin recognition complex, subunit 4 homolog antibody
    • Origin recognition complex, subunit 4, S. cerevisiae, homolog-like antibody
    see all

Images

  • All lanes : Anti-ORC4L antibody (ab235514) at 1/200 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 50 kDa

  • Paraffin-embedded human placenta tissue stained for ORC4L using ab235514 at 1/100 dilution in immunohistochemical analysis.

References

ab235514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up