Overview

  • Product name

    Anti-Orexin Receptor 1/Ox-1-R antibody - N-terminal
  • Description

    Rabbit polyclonal to Orexin Receptor 1/Ox-1-R - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Orexin Receptor 1/Ox-1-R aa 1-48 (N terminal).
    Sequence:

    MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV


    Database link: O43613

  • Positive control

    • IHC-P: Human cerebellum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Seems to be exclusively coupled to the G(q) subclass of heteromeric G proteins, which activates the phospholipase C mediated signaling cascade.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HCRTR 1 antibody
    • HCRTR1 antibody
    • Hypocretin receptor type 1 antibody
    • Orexin Receptor 1 antibody
    • Orexin receptor type 1 antibody
    • Ox-1-R antibody
    • Ox1-R antibody
    • Ox1r antibody
    • OX1R_HUMAN antibody
    see all

Images

  • Paraffin-embedded human cerebellum tissue stained for Orexin Receptor 1/Ox-1-R using ab224368 at 1/20 dilution in immunohistochemical analysis.

References

ab224368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up