Overview

  • Product name

    Anti-ornithine aminotransferase antibody
    See all ornithine aminotransferase primary antibodies
  • Description

    Rabbit polyclonal to ornithine aminotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human ornithine aminotransferase aa 1-301. (Expressed in E.coli).
    Sequence:

    MNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSS TDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGV VVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIV LLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALE VLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDW DAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILS F


    Database link: P04181-2

  • Positive control

    • WB: Recombinant human ornithine aminotransferase protein; Pig liver and kidney lysates; Rat testis and pancreas lysates. IHC-P: Human lung cancer, colorectal cancer, kidney, glioma and liver tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 33, 49 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Ornithine aminotransferase (OAT) is a key mitochondrial enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. OAT has also been linked with prostate cancer and alternatively activated macrophages
  • Cellular localization

    Mitochondrion matrix.
  • Database links

  • Alternative names

    • GACR antibody
    • Gyrate atrophy antibody
    • HOGA antibody
    • OAT antibody
    • OATASE antibody
    • OKT antibody
    • Ornithine aminotransferase (gyrate atrophy) antibody
    • Ornithine aminotransferase mitochondrial antibody
    • ornithine aminotransferase precursor antibody
    • Ornithine aminotransferase, mitochondrial precursor antibody
    • Ornithine delta aminotransferase antibody
    • Ornithine oxo acid aminotransferase antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for ornithine aminotransferase using ab231808 at 30 μg/ml in immunohistochemical analysis.

  • Paraffin-embedded human colorectal cancer tissue stained for ornithine aminotransferase using ab231808 at 20 μg/ml in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for ornithine aminotransferase using ab231808 at 20 μg/ml in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for ornithine aminotransferase using ab231808 at 20 μg/ml in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for ornithine aminotransferase using ab231808 at 20 μg/ml in immunohistochemical analysis.

  • Anti-ornithine aminotransferase antibody (ab231808) at 1 µg/ml + Recombinant human ornithine aminotransferase protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 33, 49 kDa

  • All lanes : Anti-ornithine aminotransferase antibody (ab231808) at 1 µg/ml

    Lane 1 : Pig liver lysate
    Lane 2 : Pig kidney lysate
    Lane 3 : Rat testis lysate
    Lane 4 : Rat pancreas lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 33, 49 kDa

References

ab231808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up