Overview

  • Product name

    Anti-Ornithine Decarboxylase/ODC antibody [ODC1/485]
    See all Ornithine Decarboxylase/ODC primary antibodies
  • Description

    Mouse monoclonal [ODC1/485] to Ornithine Decarboxylase/ODC
  • Host species

    Mouse
  • Tested applications

    Suitable for: IP, WB, IHC-Fr, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chinese hamster
  • Immunogen

    Recombinant full length protein corresponding to Human Ornithine Decarboxylase/ODC aa 1-461.
    Sequence:

    MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILK KHLRWLKALP RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLV QSLGVPPERIIYANPCKQVSQI KYAANNGVQMMTFDSEVELMKVARAH PKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL LERAKELNIDVVGV SFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG SE DVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIA KKIVLKEQ TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLL QKRPKPDEKYYSSSIWGPTC DGLDRIVERCDLPEMHVGDWMLFENMGA YTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF QNPDFPPEVEEQDAST LPVSCAWESGMKRHRAACASASINV


    Database link: P11926

  • Positive control

    • Recombinant Human Ornithine Decarboxylase/ODC protein (ab114536) can be used as a positive control in WB. Human prostate carcinoma. Epithelial cells in normal placenta or prostate carcinoma.
  • General notes

    Previously labelled as Ornithine Decarboxylase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab193338 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 0.25-0.5 µg/mg of lysate.
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 51 kDa.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Anti-Ornithine Decarboxylase/ODC antibody [ODC1/485] (ab193338) at 1 µg/ml + Human placenta tissue lysate

    Predicted band size: 51 kDa

  • Immunohistochemical analysis of formalin fixed paraffin embedded human prostate carcinoma labeling Ornithine Decarboxylase/ODC with ab193338 at 0.5 μg/ml

References

This product has been referenced in:

  • Pan P  et al. Black raspberries suppress colonic adenoma development in ApcMin/+ mice: relation to metabolite profiles. Carcinogenesis 36:1245-53 (2015). Read more (PubMed: 26246425) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193338.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up