Overview

  • Product name
    Anti-Orosomucoid 2 antibody
    See all Orosomucoid 2 primary antibodies
  • Description
    Rabbit polyclonal to Orosomucoid 2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Orosomucoid 2 aa 19-207. (Expressed in E.coli).
    Sequence:

    QNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFF NLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFA DLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVG MDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA


    Database link: P07361

  • Positive control
    • WB: Recombinant mouse Orosomucoid 2 protein; mouse heart, liver and cerebrum tissue lysate; mouse serum and human urine. IHC-P: Mouse liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 24 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance
    Orosomucoid 2 is a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however Orosomucoid 2 appears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • AGP B' antibody
    • AGP 2 antibody
    • AGP B antibody
    • AGP2 antibody
    • Alpha 1 acid glycoprotein 2 antibody
    • Alpha 1 acid glycoprotein type 2 antibody
    • OMD 2 antibody
    • ORM 2 antibody
    • Orosomucoid2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for Orosomucoid 2 using ab231906 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Orosomucoid 2 antibody (ab231906) at 1 µg/ml + Recombinant mouse Orosomucoid 2 protein

    Developed using the ECL technique.

    Predicted band size: 24 kDa
    Observed band size: 26 kDa
    why is the actual band size different from the predicted?

  • Anti-Orosomucoid 2 antibody (ab231906) at 1 µg/ml + Mouse heart tissue lysate

    Developed using the ECL technique.

    Predicted band size: 24 kDa

  • Anti-Orosomucoid 2 antibody (ab231906) at 1 µg/ml + Mouse serum

    Developed using the ECL technique.

    Predicted band size: 24 kDa

  • Anti-Orosomucoid 2 antibody (ab231906) at 1 µg/ml + Mouse liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 24 kDa

  • Anti-Orosomucoid 2 antibody (ab231906) at 1 µg/ml + Mouse cerebrum tissue lysate

    Developed using the ECL technique.

    Predicted band size: 24 kDa

  • Anti-Orosomucoid 2 antibody (ab231906) at 1 µg/ml + Human urine

    Developed using the ECL technique.

    Predicted band size: 24 kDa

References

ab231906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up