Overview

  • Product name

    Anti-ORP-11 antibody - N-terminal
  • Description

    Rabbit polyclonal to ORP-11 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide within Human ORP-11 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_073613.2).
    Sequence:

    MQGGEPVSTMKVSESEGKLEGQATAVTPNKNSSCGGGISSSSSSRGGSAK


    Database link: Q9BXB4

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.
  • General notes

    Previously labelled as OSBPL11. 

Properties

Applications

Our Abpromise guarantee covers the use of ab194957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 84 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-ORP-11 antibody - N-terminal (ab194957) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH/3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 84 kDa


    Exposure time: 3 minutes


    Lysates prepared using NETN lysis buffer.

  • Detection of ORP-11 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab194957 at 6 µg/mg lysate for IP and at 0.1 µg/ml for subsequent Western blot detection.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab194957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up