Overview

  • Product name

  • Description

    Rabbit polyclonal to ORP-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ORP-3 aa 310-423.
    Sequence:

    TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAERE KLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLD SPAVAKSGDNLAEE


    Database link: Q9H4L5

  • Positive control

    • WB: A431 cell lysate. IHC-P: Human urinary bladder tissue. ICC/IF: A431 cells.
  • General notes

    Previously labelled as OSBPL3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab224212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 101 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Isoform 1a, isoform 1b, isoform 1c and isoform 1d are highly expressed in brain, bone marrow, colon, kidney, lung, skeletal muscle, spleen, thymus and thyroid. Not expressed in heart and liver. Isoform 2a, isoform 2b, isoform 2c and isoform 2d are expressed in brain, bone marrow, kidney, skeletal muscle, spleen, thymus and thyroid. Not expressed in heart, liver and lung.
  • Sequence similarities

    Belongs to the OSBP family.
    Contains 1 PH domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp667P1518 antibody
    • KIAA0704 antibody
    • MGC21526 antibody
    • ORP 3 antibody
    • ORP-3 antibody
    • ORP3 antibody
    • OSBL3_HUMAN antibody
    • OSBP related protein 3 antibody
    • OSBP-related protein 3 antibody
    • OSBP3 antibody
    • Osbpl3 antibody
    • Oxysterol binding protein 3 antibody
    • Oxysterol binding protein like 3 antibody
    • Oxysterol binding protein related protein 3 antibody
    • Oxysterol-binding protein-related protein 3 antibody
    see all

Images

  • Anti-ORP-3 antibody (ab224212) at 1/250 dilution + A431 (human epidermoid carcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 101 kDa

  • Paraffin-embedded human urinary bladder tissue stained for ORP-3 using ab224212 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for ORP-3 (green) using ab224212 at 4 µg/ml in ICC/IF.

References

ab224212 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224212.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up