Overview

  • Product name

  • Description

    Rabbit polyclonal to ORP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human ORP1 aa 900-930 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    QRAARKNRSKSEEDWKTRWFHQGPNPYNGAQ


    Database link: Q9BXW6

  • Positive control

    • Rat testis tissue; Mouse brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 108 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(or 1/50 -1/200 using a fluorescent secondary antibody).

Target

Images

  • Anti-ORP1 antibody (ab203352) at 1/300 dilution (at 4°C) + Mouse brain lysate

    Secondary
    Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated (90min in 37°C) at 1/5000 dilution

    Predicted band size: 108 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded rat testis tissue labeling ORP1 with ab203352 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Cianciola NL  et al. Adenovirus Modulates Toll-Like Receptor 4 Signaling by Reprogramming ORP1L-VAP Protein Contacts for Cholesterol Transport from Endosomes to the Endoplasmic Reticulum. J Virol 91:N/A (2017). Read more (PubMed: 28077646) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up