Overview

  • Product name

  • Description

    Rabbit polyclonal to ORP150
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chinese hamster
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human ORP150 aa 695-994. (Expressed in E.coli).
    Sequence:

    MVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDLEKQEREKAANSLE AFIFETQDKLYQPEYQEVSTEEQREEISGKLSAASTWLEDEGVGATTVML KEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPE MDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAK MMALDREVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPP AGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPL


    Database link: Q9Y4L1

  • Positive control

    • WB: Recombinant human ORP150 protein; Human serum; Human lung lysate; Mouse heart lysate. IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 111 kDa.

Target

  • Function

    Has a pivotal role in cytoprotective cellular mechanisms triggered by oxygen deprivation. May play a role as a molecular chaperone and participate in protein folding.
  • Tissue specificity

    Highly expressed in tissues that contain well-developed endoplasmic reticulum and synthesize large amounts of secretory proteins. Highly expressed in liver and pancreas and lower expression in brain and kidney. Also expressed in macrophages within aortic atherosclerotic plaques, and in breast cancers.
  • Sequence similarities

    Belongs to the heat shock protein 70 family.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • 150 kDa oxygen regulated protein antibody
    • 150 kDa oxygen-regulated protein antibody
    • 170 kDa glucose regulated protein antibody
    • 170 kDa glucose-regulated protein antibody
    • DKFZp686N08236 antibody
    • FLJ94899 antibody
    • FLJ97572 antibody
    • glucose regulated protein 170 antibody
    • Grp 170 antibody
    • GRP-170 antibody
    • Grp170 antibody
    • HSP 12A antibody
    • HSP12A antibody
    • Hyou1 antibody
    • HYOU1_HUMAN antibody
    • Hypoxia up regulated 1 antibody
    • hypoxia up-regulated 1 precursor antibody
    • Hypoxia up-regulated protein 1 antibody
    • Hypoxia upregulated 1 antibody
    • Orp 150 antibody
    • ORP-150 antibody
    • Orp150 antibody
    • oxygen regulated protein (150kD) antibody
    see all

Images

  • Anti-ORP150 antibody (ab232902) at 2 µg/ml + Recombinant human ORP150 protein

    Predicted band size: 111 kDa

  • Anti-ORP150 antibody (ab232902) at 2 µg/ml + Human serum

    Predicted band size: 111 kDa

  • Anti-ORP150 antibody (ab232902) at 2 µg/ml + Human lung lysate

    Predicted band size: 111 kDa

  • Anti-ORP150 antibody (ab232902) at 2 µg/ml + Mouse heart lysate

    Predicted band size: 111 kDa

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for ORP150 using ab232902 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up