Overview

  • Product name

  • Description

    Rabbit polyclonal to ORP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ORP2 aa 251-480.
    Sequence:

    QYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNKKKLFMIYG KWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVA QETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPT DCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEAEWQTRWFY PGNNPYTGTPDWLYAGDYFERNFSDCPDIY


    Database link: Q9H1P3

  • Positive control

    • WB: HepG2 and HeLa whole cell lysate; Mouse heart lysate. IHC-P: Human tonsil tissue.
  • General notes

     This product was previously labelled as OSBPL2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 55 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds phospholipids; exhibits strong binding to phosphatidic acid and weak binding to phosphatidylinositol 3-phosphate (PubMed:11279184). Binds 25-hydroxycholesterol (PubMed:17428193).
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Deafness, autosomal dominant, 67
  • Sequence similarities

    Belongs to the OSBP family.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20223 antibody
    • KIAA0772 antibody
    • MGC4307 antibody
    • MGC8342 antibody
    • ORP-2 antibody
    • ORP2 antibody
    • OSBL2_HUMAN antibody
    • OSBP related protein 2 antibody
    • OSBP-related protein 2 antibody
    • OSBPL2 antibody
    • Oxysterol binding protein like 2 antibody
    • Oxysterol binding protein related protein 2 antibody
    • Oxysterol-binding protein-related protein 2 antibody
    see all

Images

  • All lanes : Anti-ORP2 antibody (ab235298) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : Mouse heart lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 55 kDa

  • Paraffin-embedded human tonsil tissue stained for ORP2 using ab235298 at 1/100 dilution in immunohistochemical analysis.

References

ab235298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up