Overview

  • Product name

  • Description

    Rabbit polyclonal to OSGEPL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human OSGEPL1 aa 1-270.
    Sequence:

    MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTA AAVVDETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALS ASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEA HALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDM LDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCD FSFTGLQHVTDKIIMKKEKE


    Database link: Q9H4B0

  • Positive control

    • WB: U-251 MG whole cell lysate. IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 45 kDa.

Target

  • Function

    Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine.
  • Sequence similarities

    Belongs to the KAE1 / YgjD family.
  • Information by UniProt
  • Database links

  • Alternative names

    • O sialoglycoprotein endopeptidase like 1 antibody
    • O sialoglycoprotein endopeptidase like protein 1 antibody
    • osgepl1 antibody
    • OSGP2_HUMAN antibody
    • Probable O sialoglycoprotein endopeptidase 2 antibody
    • Probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1 antibody
    • Putative sialoglycoprotease type 2 antibody
    • Qri7 antibody
    • t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1 antibody
    see all

Images

  • Paraffin-embedded human prostate cancer tissue stained for OSGEPL1 using ab234883 at 1/100 dilution in immunohistochemical analysis.

     

  • Anti-OSGEPL1 antibody (ab234883) at 1/1000 dilution + U-251 MG (Human brain glioma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 45 kDa

References

ab234883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up