Overview

  • Product name

    OsK-1, K+ channel blocker
  • Description

    Potent K+ channel blocker. Toxin.
  • Biological description

    Potent K+ channel blocker (IC50 values are 0.6, 5.4 nM and 14 pM at Kv1.1, 1.2 and 1.3 respectively). Immunosuppressive agent. Active in vivo and in vitro.
  • Purity

    > 98%
  • CAS Number

    183815-75-0
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4205.00
  • Molecular formula

    C177H300N56O46S8
  • Sequence

    GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK (Modifications: Disulfide bonds: 8-28, 14-33, 18-35)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Orthochirus scrobiculosus

  • Research areas

References

This product has been referenced in:

  • Mouhat S  et al. Pharmacological profiling of Orthochirus scrobiculosus toxin 1 analogs with a trimmed N-terminal domain. Mol Pharmacol 69:354-62 (2006). Read more (PubMed: 16234482) »
  • Mouhat S  et al. K+ channel types targeted by synthetic OSK1, a toxin from Orthochirus scrobiculosus scorpion venom. Biochem J 385:95-104 (2005). Read more (PubMed: 15588251) »
  • Potapenko NA  et al. [Complete amino acid sequence of neurotoxin Os-1 from the venom of the Central Asian black scorpion Orthochirus scrobiculosus]. Bioorg Khim 12:581-90 (1986). Read more (PubMed: 3730007) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up