Overview

  • Product name

  • Description

    Rabbit polyclonal to Osteopontin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rhesus monkey Osteopontin aa 18-314. N-terminal tag. Expressed in E. coli.
    Sequence:

    MGHHHHHHSGS-PVKQADSGSSEEKQLYNKYPDAVATWLKPDPSQKQNLL APQNAVSSEETNDFKQETLPSKSNESHDHMDDVDDEDDDDHVDSQDSIDS NDSDEVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDI YDGRGDSVAYGLRSKSKKFRRPDIQYPDATDEDITSHVESEELNGAYKAI PVVQGLNVPSDWDSRGKDSHETSQLDDHSAETHSHKHSRLYKRKASDDSN EHSDVIDSQERSKISHEFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHE LDSASSEVN


    Database link: F6V2X3

  • Positive control

    • IHC-P: Human cerebrum and kidney tissue. WB: Recombinant rhesus monkey Osteopontin protein. HeLa cell lysate. Pig kidney tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 35 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.
    Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity.
  • Tissue specificity

    Bone. Found in plasma.
  • Sequence similarities

    Belongs to the osteopontin family.
  • Post-translational
    modifications

    Extensively phosphorylated on clustered serine residues.
    N- and O-glycosylated.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BNSP antibody
    • Bone sialoprotein 1 antibody
    • Bone sialoprotein I antibody
    • BSP I antibody
    • BSPI antibody
    • Early T lymphocyte activation 1 antibody
    • ETA 1 antibody
    • ETA1 antibody
    • MGC110940 antibody
    • Nephropontin antibody
    • OPN antibody
    • Osteopontin antibody
    • osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein antibody
    • OSTP_HUMAN antibody
    • PSEC0156 antibody
    • secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1) antibody
    • secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) antibody
    • Secreted phosphoprotein 1 antibody
    • SPP 1 antibody
    • SPP-1 antibody
    • SPP1 antibody
    • SPP1/CALPHA1 fusion antibody
    • Urinary stone protein antibody
    • Uropontin antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Osteopontin with ab231736 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Osteopontin with ab231736 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Osteopontin antibody (ab231736) at 2 µg/ml + Pig kidney tissue lysate

    Predicted band size: 35 kDa

  • Anti-Osteopontin antibody (ab231736) at 2 µg/ml + HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 35 kDa

  • Anti-Osteopontin antibody (ab231736) at 2 µg/ml + Recombinant rhesus monkey Osteopontin protein

    Predicted band size: 35 kDa

References

ab231736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up