Anti-Osteoprotegerin antibody (ab203061)

Rabbit polyclonal Osteoprotegerin antibody. Validated in WB, IHC and tested in Mouse, Rat. Cited in 1 publication(s). Immunogen corresponding to synthetic peptide.

Overview

  • Product name

    Anti-Osteoprotegerin antibody
    See all Osteoprotegerin primary antibodies
  • Description

    Rabbit polyclonal to Osteoprotegerin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Mouse Osteoprotegerin aa 235-280 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ESVERIKRRHSSQEQTFQLLKLWKHQNRDQEMVKKIIQDIDLCESS


    Database link: O08712

  • Positive control

    • IHC-P: Rat tibia and mouse bone tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/300.

Target

  • Function

    Acts as decoy receptor for RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local RANKL/OPG ratio. May also play a role in preventing arterial calcification. May act as decoy receptor for TRAIL and protect against apoptosis. TRAIL binding blocks the inhibition of osteoclastogenesis.
  • Tissue specificity

    Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.
  • Involvement in disease

    Defects in TNFRSF11B are the cause of juvenile Paget disease (JPD) [MIM:239000]; also known as hyperostosis corticalis deformans juvenilis or hereditary hyperphosphatasia or chronic congenital idiopathic hyperphosphatasia. JPD is a rare autosomal recessive osteopathy that presents in infancy or early childhood. The disorder is characterized by rapidly remodeling woven bone, osteopenia, debilitating fractures, and deformities due to a markedly accelerated rate of bone remodeling throughout the skeleton. Approximately 40 cases of JPD have been reported worldwide. Unless it is treated with drugs that block osteoclast-mediated skeletal resorption, the disease can be fatal.
  • Sequence similarities

    Contains 2 death domains.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications

    N-glycosylated. Contains sialic acid residues.
    The N-terminus is blocked.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC29565 antibody
    • OCIF antibody
    • OPG antibody
    • Osteoclastogenesis inhibitory factor antibody
    • Osteoprotegerin antibody
    • PDB5 antibody
    • TNF receptor superfamily member 11b antibody
    • TNFRSF 11B antibody
    • TNFRSF11B antibody
    • TR 1 antibody
    • TR1 antibody
    • TR11B_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 11B antibody
    see all

Images

  • All lanes : Anti-Osteoprotegerin antibody (ab203061) at 1/300 dilution

    Lane 1 : Mouse heart lysates
    Lane 2 : Mouse kidney lysates

    Secondary
    All lanes : Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat tibia tissue, labeling Osteoprotegerin using ab203061 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse bone (decalcified in EDTA), labeling Osteoprotegerin using ab203061 at a 1/100 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • He XF  et al. Berberine alleviates oxidative stress in rats with osteoporosis through receptor activator of NF-kB/receptor activator of NF-kB ligand/osteoprotegerin (RANK/RANKL/OPG) pathway. Bosn J Basic Med Sci 17:295-301 (2017). Read more (PubMed: 29055350) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up