Overview

  • Product name

    Anti-Ovoinhibitor antibody (HRP)
  • Description

    Rabbit polyclonal to Ovoinhibitor (HRP)
  • Host species

    Rabbit
  • Conjugation

    HRP
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Chicken
  • Immunogen

    Recombinant fragment corresponding to Chicken Ovoinhibitor aa 26-472.
    Sequence:

    VNCSLYASGIGKDGTSWVACPRNLKPVCGTDGSTYSNECGICLYNREHGA NVEKEYDGECRPKHVMIDCSPYLQVVRDGNTMVACPRILKPVCGSDSFTY DNECGICAYNAEHHTNISKLHDGECKLEIGSVDCSKYPSTVSKDGRTLVA CPRILSPVCGTDGFTYDNECGICAHNAEQRTHVSKKHDGKCRQEIPEIDC DQYPTRKTTGGKLLVRCPRILLPVCGTDGFTYDNECGICAHNAQHGTEVK KSHDGRCKERSTPLDCTQYLSNTQNGEAITACPFILQEVCGTDGVTYSND CSLCAHNIELGTSVAKKHDGRCREEVPELDCSKYKTSTLKDGRQVVACTM IYDPVCATNGVTYASECTLCAHNLEQRTNLGKRKNGRCEEDITKEHCREF QKVSPICTMEYVPHCGSDGVTYSNRCFFCNAYVQSNRTLNLVSMAAC


    Database link: P10184

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 52 kDa.

Target

  • Relevance

    Seems to have at least five active inhibitory domains; two for trypsin, two for chymotrypsin and one for elastase.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • OIH antibody

References

This product has been referenced in:

  • He T  et al. Proteomic comparison by iTRAQ combined with mass spectrometry of egg white proteins in laying hens (Gallus gallus) fed with soybean meal and cottonseed meal. PLoS One 12:e0182886 (2017). Read more (PubMed: 28813468) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up