Overview

  • Product name

    Anti-P Glycoprotein antibody
    See all P Glycoprotein primary antibodies
  • Description

    Rabbit polyclonal to P Glycoprotein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human P Glycoprotein aa 236-297.
    Sequence:

    LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAK RIGIKKAITANI


    Database link: P08183

  • Positive control

    • WB: HepG2 and EC109 whole cell lysate. IHC-P: Human liver cancer and placenta tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
  • Tissue specificity

    Expressed in liver, kidney, small intestine and brain.
  • Involvement in disease

    Genetic variations in ABCB1 are associated with susceptibility to inflammatory bowel disease type 13 (IBD13) [MIM:612244]. Inflammatory bowel disease is characterized by a chronic relapsing intestinal inflammation. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may involve any part of the gastrointestinal tract, but most frequently the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints. Crohn disease and ulcerative colitis are commonly classified as autoimmune diseases.
  • Sequence similarities

    Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
    Contains 2 ABC transmembrane type-1 domains.
    Contains 2 ABC transporter domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABC20 antibody
    • ABCB1 antibody
    • ATP binding cassette, sub family B (MDR/TAP), member 1 antibody
    • ATP-binding cassette sub-family B member 1 antibody
    • CD243 antibody
    • CLCS antibody
    • Colchicin sensitivity antibody
    • Doxorubicin resistance antibody
    • GP170 antibody
    • MDR1 antibody
    • MDR1_HUMAN antibody
    • Multidrug resistance 1 antibody
    • Multidrug resistance protein 1 antibody
    • P glycoprotein 1 antibody
    • P gp antibody
    • P-glycoprotein 1 antibody
    • PGY1 antibody
    see all

Images

  • All lanes : Anti-P Glycoprotein antibody (ab235954) at 1/500 dilution

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : EC109 whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for P Glycoprotein using ab235954 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human placenta tissue stained for P Glycoprotein with ab235954 at a 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for P Glycoprotein with ab235954 at a 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Meng D  et al. MicroRNA-645 targets urokinase plasminogen activator and decreases the invasive growth of MDA-MB-231 triple-negative breast cancer cells. Onco Targets Ther 11:7733-7743 (2018). Read more (PubMed: 30464522) »
  • Li J  et al. MicroRNA-140-3p enhances the sensitivity of hepatocellular carcinoma cells to sorafenib by targeting pregnenolone X receptor. Onco Targets Ther 11:5885-5894 (2018). Read more (PubMed: 30271172) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up