Overview

  • Product name

  • Description

    Rabbit polyclonal to p0071
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human p0071 aa 151-234.
    Sequence:

    SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLV QPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSR


    Database link: Q99569

  • Positive control

    • ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as Plakophilin 4. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May play a role in junctional plaques.
  • Sequence similarities

    Belongs to the beta-catenin family.
    Contains 9 ARM repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell junction > desmosome. Colocalized with desmoplakin at desmosomal junctional plaques in cultured epithelial cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • Catenin 4 antibody
    • Catenin4 antibody
    • FLJ31261 antibody
    • FLJ42243 antibody
    • p0071 antibody
    • PKP 4 antibody
    • PKP4 antibody
    • PKP4_HUMAN antibody
    • Plakophilin 4 antibody
    • Plakophilin-4 antibody
    • Plakophilin4 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for p0071 (green) using ab222194 at 4 µg/ml in ICC/IF.

References

ab222194 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up