Overview

  • Product name

  • Description

    Rabbit polyclonal to p107
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human p107 aa 564-647.
    Sequence:

    ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMP MSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER


    Database link: P28749

  • Positive control

    • IHC-P: Human lymph node, testis, colon and kidney tissues. WB: U-251 MG cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 121 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. Potent inhibitor of E2F-mediated trans-activation. Forms a complex with adenovirus E1A and with SV40 large T antigen. May bind and modulate functionally certain cellular proteins with which T and E1A compete for pocket binding. May act as a tumor suppressor.
  • Sequence similarities

    Belongs to the retinoblastoma protein (RB) family.
  • Post-translational
    modifications

    Exists in both phosphorylated and unphosphorylated forms, and T, but not E1A, binds only to the unphosphorylated form. Cell-cycle arrest properties are inactivated by phosphorylation on Thr-332, Ser-640, Ser-964 and Ser-975 by CDK4.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 107 kDa retinoblastoma-associated protein antibody
    • Cellular protein 107 antibody
    • Cellular protein p107 antibody
    • CP107 antibody
    • MGC40006 antibody
    • p107 antibody
    • PRB1 antibody
    • RBL1 antibody
    • RBL1_HUMAN antibody
    • Retinoblastoma like protein 1 antibody
    • retinoblastoma-like 1 (p107) antibody
    • Retinoblastoma-like protein 1 antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for p107 using ab244504 at 1/500 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma cells stained for p107 (green) using ab244504 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-p107 antibody (ab244504) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 121 kDa

  • Paraffin-embedded human cerebral cortex tissue stained for p107 using ab244504 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human kidney tissue stained for p107 using ab244504 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for p107 using ab244504 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human lymph node tissue stained for p107 using ab244504 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human pancreas tissue stained for p107 using ab244504 at 1/500 dilution in immunohistochemical analysis.

References

ab244504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up