Anti-p115-RhoGEF antibody (ab220892)
Key features and details
- Rabbit polyclonal to p115-RhoGEF
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-p115-RhoGEF antibody
See all p115-RhoGEF primary antibodies -
Description
Rabbit polyclonal to p115-RhoGEF -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human p115-RhoGEF aa 110-224.
Sequence:LRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRS KRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTIS TDEEKSAAVVNAIGL
Database link: Q92888 -
Positive control
- WB: RT-4 and U-251 MG cell lysates. ICC/IF: A549 cells.
-
General notes
Previously labelled as ARHGEF1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220892 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 102 kDa. |
Target
-
Function
Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2-induced RhoA activation. -
Tissue specificity
Ubiquitously expressed. -
Sequence similarities
Contains 1 DH (DBL-homology) domain.
Contains 1 PH domain.
Contains 1 RGSL (RGS-like) domain. -
Domain
The RGSL domain, also known as rgRGS domain, is necessary but not sufficient for GAP activity.
The DH domain is involved in interaction with CCPG1. -
Post-translational
modificationsPhosphorylated by PKCA. Angiotensin-2 induced Tyr-738 phosphorylation is mediated by JAK2. -
Cellular localization
Cytoplasm. Membrane. Translocated to the membrane by activated GNA13 or LPA stimulation. - Information by UniProt
-
Database links
- Entrez Gene: 9138 Human
- Entrez Gene: 16801 Mouse
- Entrez Gene: 60323 Rat
- Omim: 601855 Human
- SwissProt: Q92888 Human
- SwissProt: Q61210 Mouse
- SwissProt: Q9Z1I6 Rat
- Unigene: 631550 Human
see all -
Alternative names
- 115 kD protein antibody
- 115 kDa guanine nucleotide exchange factor antibody
- ARHG1_HUMAN antibody
see all
Images
-
All lanes : Anti-p115-RhoGEF antibody (ab220892) at 1/100 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 102 kDa -
Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized A549 cells labeling p115-RhoGEF using ab220882 at 4 μg/mL (green).
Protocols
Datasheets and documents
References (1)
ab220892 has been referenced in 1 publication.
- Fu J et al. 1, 6-di-O-caffeoyl-ß-D-glucopyranoside, a natural compound from Callicarpa nudiflora Hook impairs P2Y12 and thromboxane A2 receptor-mediated amplification of platelet activation and aggregation. Phytomedicine 36:273-282 (2017). PubMed: 29157825