Anti-p115-RhoGEF antibody (ab220892)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-p115-RhoGEF antibody
See all p115-RhoGEF primary antibodies -
Description
Rabbit polyclonal to p115-RhoGEF -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human p115-RhoGEF aa 110-224.
Sequence:LRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRS KRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTIS TDEEKSAAVVNAIGL
Database link: Q92888 -
Positive control
- WB: RT-4 and U-251 MG cell lysates. ICC/IF: A549 cells.
-
General notes
Previously labelled as ARHGEF1.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220892 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
|
| WB | 1/100 - 1/250. Predicted molecular weight: 102 kDa. |
Target
-
Function
Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2-induced RhoA activation. -
Tissue specificity
Ubiquitously expressed. -
Sequence similarities
Contains 1 DH (DBL-homology) domain.
Contains 1 PH domain.
Contains 1 RGSL (RGS-like) domain. -
Domain
The RGSL domain, also known as rgRGS domain, is necessary but not sufficient for GAP activity.
The DH domain is involved in interaction with CCPG1. -
Post-translational
modificationsPhosphorylated by PKCA. Angiotensin-2 induced Tyr-738 phosphorylation is mediated by JAK2. -
Cellular localization
Cytoplasm. Membrane. Translocated to the membrane by activated GNA13 or LPA stimulation. - Information by UniProt
-
Database links
- Entrez Gene: 9138 Human
- Entrez Gene: 16801 Mouse
- Entrez Gene: 60323 Rat
- Omim: 601855 Human
- SwissProt: Q92888 Human
- SwissProt: Q61210 Mouse
- SwissProt: Q9Z1I6 Rat
- Unigene: 631550 Human
see all -
Alternative names
- 115 kD protein antibody
- 115 kDa guanine nucleotide exchange factor antibody
- ARHG1_HUMAN antibody
see all
Images
-
Western blot - Anti-p115-RhoGEF antibody (ab220892)All lanes : Anti-p115-RhoGEF antibody (ab220892) at 1/100 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 102 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-p115-RhoGEF antibody (ab220892)Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized A549 cells labeling p115-RhoGEF using ab220882 at 4 μg/mL (green).
Datasheets and documents
References
This product has been referenced in:
- Fu J et al. 1, 6-di-O-caffeoyl-ß-D-glucopyranoside, a natural compound from Callicarpa nudiflora Hook impairs P2Y12 and thromboxane A2 receptor-mediated amplification of platelet activation and aggregation. Phytomedicine 36:273-282 (2017). Read more (PubMed: 29157825) »
