Overview

  • Product name

  • Description

    Rabbit polyclonal to p115-RhoGEF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human p115-RhoGEF aa 225-338.
    Sequence:

    YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARW NRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGV SLHPLSLDSPDREP


    Database link: Q92888

  • Positive control

    • WB: RT4, U-251 MG sp, NIH/3T3 and NBT-II cell lysates. IHC-P: Human lymph node tissue. ICC/IF: U-2 OS cells.
  • General notes

    Previously labelled as ARHGEF1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 102.4 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100

Target

  • Function

    Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2-induced RhoA activation.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 RGSL (RGS-like) domain.
  • Domain

    The RGSL domain, also known as rgRGS domain, is necessary but not sufficient for GAP activity.
    The DH domain is involved in interaction with CCPG1.
  • Post-translational
    modifications

    Phosphorylated by PKCA. Angiotensin-2 induced Tyr-738 phosphorylation is mediated by JAK2.
  • Cellular localization

    Cytoplasm. Membrane. Translocated to the membrane by activated GNA13 or LPA stimulation.
  • Information by UniProt
  • Database links

  • Alternative names

    • 115 kD protein antibody
    • 115 kDa guanine nucleotide exchange factor antibody
    • ARHG1_HUMAN antibody
    • ARHGEF 1 antibody
    • ARHGEF1 antibody
    • GEF 1 antibody
    • GEF1 antibody
    • LBCL 2 antibody
    • LBCL2 antibody
    • LSC antibody
    • Lsc homolog antibody
    • p115 RhoGEF antibody
    • p115-RhoGEF antibody
    • p115RhoGEF antibody
    • Rho guanine nucleotide exchange factor (GEF) 1 antibody
    • Rho guanine nucleotide exchange factor 1 antibody
    • Sub1.5 antibody
    see all

Images

  • Paraffin embedded sections of human lymph node tissue stained for p115-RhoGEF with ab223759 at 1/500 dilution in immunohistochemical analysis.

  • Negative Control: Paraffin embedded sections of human cerebral cortex tissue stained for p115-RhoGEF with ab223759 at 1/500 dilution in immunohistochemical analysis.

  • All lanes : Anti-p115-RhoGEF antibody (ab223759) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 102.4 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for p115-RhoGEF (green) using ab223759 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-p115-RhoGEF antibody (ab223759) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp cell lysate

    Predicted band size: 102.4 kDa

  • Paraffin embedded sections of human lymph node tissue stained for p115-RhoGEF with ab223759 at 1/500 dilution in immunohistochemical analysis.

References

ab223759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up