Anti-p170 antibody (ab151139)
Key features and details
- Rabbit polyclonal to p170
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-p170 antibody -
Description
Rabbit polyclonal to p170 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human p170 aa 1155-1258.
Sequence:LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVD VGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYY ADAL
Database link: Q86X10 -
Positive control
- IHC-P: Human cerebellum, testis, urinary bladder, skeletal muscle tissue ICC/IF: Caco-2 cells
-
General notes
Previously labelled as RALGAPB.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab151139 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
|
IHC-P |
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
IHC-P
1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
Non-catalytic subunit of the heterodimeric RalGAP1 and RalGAP2 complexes which act as GTPase activators for the Ras-like small GTPases RALA and RALB -
Database links
- Entrez Gene: 57148 Human
- Entrez Gene: 228850 Mouse
- Entrez Gene: 362257 Rat
- SwissProt: Q86X10 Human
- SwissProt: Q8BQZ4 Mouse
- SwissProt: P86410 Rat
-
Alternative names
- dJ1100H13.1 antibody
- KIAA1219 antibody
- p170 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
Paraffin embedded human cerebellum tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Caco-2 cells stained for p170 (green) using ab151139 at 2 µg/ml dilution in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
Paraffin embedded human testis tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
Paraffin embedded human urinary bladder tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p170 antibody (ab151139)
Paraffin embedded human skeletal muscle tissue stained for p170 using ab151139 at 1/200 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab151139 has not yet been referenced specifically in any publications.