Overview

  • Product name

    Anti-p170 antibody
  • Description

    Rabbit polyclonal to p170
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human p170 aa 1155-1258.
    Sequence:

    LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVD VGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYY ADAL


    Database link: Q86X10

  • Positive control

    • Human cerebellum tissue
  • General notes

    Previously labelled as RALGAPB. 

Properties

Applications

Our Abpromise guarantee covers the use of ab151139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Non-catalytic subunit of the heterodimeric RalGAP1 and RalGAP2 complexes which act as GTPase activators for the Ras-like small GTPases RALA and RALB
  • Database links

  • Alternative names

    • dJ1100H13.1 antibody
    • KIAA1219 antibody
    • p170 antibody
    • Ral GTPase activating protein, beta subunit (non-catalytic) antibody
    • Ral GTPase-activating protein subunit beta antibody
    • RALGAPB antibody
    • RalGAPbeta antibody
    • RP5-1100H13.1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human cerebellum tissue labelling p170 with ab151139 antibody at a dilution of 1/50.

References

ab151139 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up