Overview

  • Product name

    Anti-p18 INK4c/CDKN2C antibody
    See all p18 INK4c/CDKN2C primary antibodies
  • Description

    Rabbit polyclonal to p18 INK4c/CDKN2C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human p18 INK4c/CDKN2C aa 1-68.
    Sequence:

    MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNP EIARRLLLRGANPDLKDR


    Database link: P42773

  • Positive control

    • IHC-P: Human colon cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as p18 INK4c

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
  • Tissue specificity

    Highest levels found in skeletal muscle. Also found in pancreas and heart.
  • Sequence similarities

    Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
    Contains 4 ANK repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDK6 inhibitor p18 antibody
    • CDKN 2C antibody
    • CDKN 6 antibody
    • Cdkn2c antibody
    • CDKN6 antibody
    • CDN2C_HUMAN antibody
    • Cyclin dependent inhibitor antibody
    • Cyclin dependent kinase 4 inhibitor C antibody
    • Cyclin dependent kinase 6 inhibitor antibody
    • Cyclin dependent kinase 6 inhibitor p18 antibody
    • Cyclin dependent kinase inhibitor 2C (p18 inhibits CDK4) antibody
    • Cyclin dependent kinase inhibitor 2C antibody
    • Cyclin-dependent kinase 4 inhibitor C antibody
    • Cyclin-dependent kinase 6 inhibitor antibody
    • INK4C antibody
    • OTTHUMP00000046546 antibody
    • p18 antibody
    • p18 inhibits CDK4 antibody
    • p18 INK4c antibody
    • p18 INK6 antibody
    • p18-INK4c antibody
    • p18-INK6 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for p18 INK4c/CDKN2C using ab238108 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for p18 INK4c/CDKN2C (green) using ab238108 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated goat anti-rabbit IgG (H+L).

References

ab238108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up