Anti-p19 INK4d antibody (ab262871)
Overview
-
Product name
Anti-p19 INK4d antibody -
Description
Rabbit polyclonal to p19 INK4d -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human p19 INK4d aa 86-138.
Sequence:FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRR DAR
Database link: P55273 -
Positive control
- ICC/IF: A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab262871 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Relevance
Cyclins are important in regulating the cell cycle through their formation of enzymatic complexes with various cyclin dependent kinases. The activity of the cyclin D dependent kinases is controlled by inhibitors such as the INK4 family, which includes INK4a, INK4b, INK4c, and INK4d (p19 INK4d). p19 INK4d is a specific inhibitor of cdk 4 / cdk 6 and is periodically expressed during cell cycle. It is maximally induced as cells enter S phase. -
Cellular localization
Cytoplasmic and Nuclear -
Database links
- Entrez Gene: 1032 Human
- Omim: 600927 Human
- SwissProt: P55273 Human
- Unigene: 435051 Human
-
Alternative names
- CDK inhibitor p19INK4d antibody
- CDKN2D antibody
- cell cycle inhibitor, Nur77 associating protein antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-p19 INK4d antibody (ab262871)PFA-fixed, Triton X-100 permeabilized human A-431 cells stained for p19 INK4d (green) using ab262871 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References
ab262871 has not yet been referenced specifically in any publications.
