Anti-p21 antibody [CIP1/823] (ab220206)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-p21 antibody [CIP1/823]
See all p21 primary antibodies -
Description
Mouse monoclonal [CIP1/823] to p21 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Does not react with: Mouse, Rat -
Immunogen
Recombinant full length protein corresponding to Human p21 aa 2-164.
Sequence:SEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNF DFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPAL LQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFY HSKRRLIFSKRKP
Database link: P38936 -
Positive control
- Human lung squamous cell carcinoma and bladder carcinoma tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.05% BSA, 99% PBS -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
ab220206 was purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
CIP1/823 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab220206 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 2 - 4 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. (Primary incubation for 30 minutes at RT). |
Target
-
Function
May be the important intermediate by which p53/TP53 mediates its role as an inhibitor of cellular proliferation in response to DNA damage. Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex. -
Tissue specificity
Expressed in all adult human tissues, with 5-fold lower levels observed in the brain. -
Sequence similarities
Belongs to the CDI family. -
Domain
The PIP-box K+4 motif mediates both the interaction with PCNA and the recuitment of the DCX(DTL) complex: while the PIP-box interacts with PCNA, the presence of the K+4 submotif, recruits the DCX(DTL) complex, leading to its ubiquitination.
The C-terminal is required for nuclear localization of the cyclin D-CDK4 complex. -
Post-translational
modificationsPhosphorylation of Thr-145 by Akt or of Ser-146 by PKC impairs binding to PCNA. Phosphorylation at Ser-114 by GSK3-beta enhances ubiquitination by the DCX(DTL) complex.
Ubiquitinated by MKRN1; leading to polyubiquitination and 26S proteasome-dependent degradation. Ubiquitinated by the DCX(DTL) complex, also named CRL4(CDT2) complex, leading to its degradation during S phase or following UV irradiation. Ubiquitination by the DCX(DTL) complex is essential to control replication licensing and is PCNA-dependent: interacts with PCNA via its PIP-box, while the presence of the containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to its degradation. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1026 Human
- Omim: 116899 Human
- SwissProt: P38936 Human
- Unigene: 370771 Human
-
Alternative names
- CAP20 antibody
- CDK-interacting protein 1 antibody
- CDKI antibody
see all
Images
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)](https://www.abcam.com/ps/products/220/ab220206/Images/ab220206-277611-anti-p21-antibody-cip1-823-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)Immunohistochemical analysis of formalin-fixed, paraffin-embedded human bladder carcinoma tissue labeling p21 with ab220206 at 4 µg/ml.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)](https://www.abcam.com/ps/products/220/ab220206/Images/ab220206-277610-anti-p21-antibody-cip1-823-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung squamous cell carcinoma tissue labeling p21 with ab220206 at 4 µg/ml.
Protocols
Datasheets and documents
References
ab220206 has not yet been referenced specifically in any publications.
