Anti-p21 antibody [CIP1/823] (ab220206)

Submit a review Submit a question

Key features and details

  • Mouse monoclonal [CIP1/823] to p21
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG2a

Overview

  • Product name

    Anti-p21 antibody [CIP1/823]
    See all p21 primary antibodies

  • Description

    Mouse monoclonal [CIP1/823] to p21

  • Host species

    Mouse

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Does not react with: Mouse, Rat

  • Immunogen

    Recombinant full length protein corresponding to Human p21 aa 2-164.
    Sequence:

    SEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNF DFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPAL LQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFY HSKRRLIFSKRKP


    Database link: P38936

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Human lung squamous cell carcinoma and bladder carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab220206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2 - 4 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    May be the important intermediate by which p53/TP53 mediates its role as an inhibitor of cellular proliferation in response to DNA damage. Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex.

  • Tissue specificity

    Expressed in all adult human tissues, with 5-fold lower levels observed in the brain.

  • Sequence similarities

    Belongs to the CDI family.

  • Domain

    The PIP-box K+4 motif mediates both the interaction with PCNA and the recuitment of the DCX(DTL) complex: while the PIP-box interacts with PCNA, the presence of the K+4 submotif, recruits the DCX(DTL) complex, leading to its ubiquitination.
    The C-terminal is required for nuclear localization of the cyclin D-CDK4 complex.

  • Post-translational
    modifications

    Phosphorylation of Thr-145 by Akt or of Ser-146 by PKC impairs binding to PCNA. Phosphorylation at Ser-114 by GSK3-beta enhances ubiquitination by the DCX(DTL) complex.
    Ubiquitinated by MKRN1; leading to polyubiquitination and 26S proteasome-dependent degradation. Ubiquitinated by the DCX(DTL) complex, also named CRL4(CDT2) complex, leading to its degradation during S phase or following UV irradiation. Ubiquitination by the DCX(DTL) complex is essential to control replication licensing and is PCNA-dependent: interacts with PCNA via its PIP-box, while the presence of the containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to its degradation.

  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

  • Database links

    • Alternative names

      • CAP20 antibody
      • CDK-interacting protein 1 antibody
      • CDKI antibody
      • CDKN1 antibody
      • Cdkn1a antibody
      • CDN1A_HUMAN antibody
      • CIP1 antibody
      • Cyclin Dependent Kinase Inhibitor 1A antibody
      • Cyclin-dependent kinase inhibitor 1 antibody
      • Cyclin-dependent kinase inhibitor 1A (P21) antibody
      • Cyclin-dependent kinase inhibitor 1A (p21, Cip1) antibody
      • DNA Synthesis Inhibitor antibody
      • MDA-6 antibody
      • MDA6 antibody
      • Melanoma differentiation-associated protein 6 antibody
      • Melanoma differentiation-associated protein antibody
      • p21 antibody
      • P21 protein antibody
      • p21CIP1 antibody
      • p21Cip1/Waf1 antibody
      • p21WAF antibody
      • PIC1 antibody
      • SDI1 antibody
      • SLC12A9 antibody
      • WAF1 antibody
      • Wild type p53 activated fragment 1 (WAF1) antibody
      • Wild type p53 activated fragment 1 antibody
      • Wildtype p53-activated fragment 1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human bladder carcinoma tissue labeling p21 with ab220206 at 4 µg/ml. 

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-p21 antibody [CIP1/823] (ab220206)

      Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung squamous cell carcinoma tissue labeling p21 with ab220206 at 4 µg/ml. 

       

    References (0)

    Publishing research using ab220206? Please let us know so that we can cite the reference in this datasheet.

    ab220206 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab220206.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com