Overview

  • Product name

  • Description

    Rabbit polyclonal to p26
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human p26 aa 120-173.
    Sequence:

    VGDEPPILPDMGNRVTALTQRFRGAYWKEVDKMVDYMQPGGTPATEGLGR LAPS


    Database link: Q9Y3Q3-2

  • Positive control

    • Human placenta tissue
  • General notes

    Previously labelled as TMED3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab151056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network.
  • Sequence similarities

    Belongs to the EMP24/GP25L family.
    Contains 1 GOLD domain.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Golgi apparatus > Golgi stack membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. Probably cycles between compartments of the early secretatory pathway.
  • Information by UniProt
  • Database links

  • Alternative names

    • C15orf22 antibody
    • Integral type I protein antibody
    • Membrane protein p24B antibody
    • p24 family protein gamma 4 antibody
    • p24 family protein gamma-4 antibody
    • P24B antibody
    • p24g4 antibody
    • p24gamma4 antibody
    • p26 antibody
    • Testis tissue sperm binding protein Li 48e antibody
    • Tmed3 antibody
    • TMED3_HUMAN antibody
    • Transmembrane emp24 domain containing protein 3 antibody
    • Transmembrane emp24 domain-containing protein 3 antibody
    • Transmembrane p24 trafficking protein 3 antibody
    • UNQ5357/PRO1078 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human placenta tissue labeling p26 with ab151056 at a 1/10 dilution.

References

This product has been referenced in:

  • Pei J  et al. TMED3 promotes cell proliferation and motility in breast cancer and is negatively modulated by miR-188-3p. Cancer Cell Int 19:75 (2019). Read more (PubMed: 30976199) »
  • Zheng H  et al. TMED3 promotes hepatocellular carcinoma progression via IL-11/STAT3 signaling. Sci Rep 6:37070 (2016). WB ; Human . Read more (PubMed: 27901021) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151056.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up