Anti-p26 antibody (ab223175)
Key features and details
- Rabbit polyclonal to p26
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-p26 antibody
See all p26 primary antibodies -
Description
Rabbit polyclonal to p26 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human p26 aa 71-100.
Sequence:DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
Database link: Q9Y3Q3 -
Positive control
- WB: RT4 and U-251 MG cell lysates. ICC/IF: BJ cells.
-
General notes
Previously labelled as TMED3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223175 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 25 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. -
Sequence similarities
Belongs to the EMP24/GP25L family.
Contains 1 GOLD domain. -
Cellular localization
Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Golgi apparatus > Golgi stack membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. Probably cycles between compartments of the early secretatory pathway. - Information by UniProt
-
Database links
- Entrez Gene: 23423 Human
- SwissProt: Q9Y3Q3 Human
- Unigene: 513058 Human
-
Alternative names
- C15orf22 antibody
- Integral type I protein antibody
- Membrane protein p24B antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized BJ cells stained for p26 (green) using ab223175 at 4 µg/ml in ICC/IF.
-
All lanes : Anti-p26 antibody (ab223175) at 1/1000 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Predicted band size: 25 kDa
Protocols
Datasheets and documents
References (0)
ab223175 has not yet been referenced specifically in any publications.