Anti-p26 antibody (ab223175)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-p26 antibody
See all p26 primary antibodies -
Description
Rabbit polyclonal to p26 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human p26 aa 71-100.
Sequence:DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
Database link: Q9Y3Q3 -
Positive control
- WB: RT4 and U-251 MG cell lysates. ICC/IF: BJ cells.
-
General notes
Previously labelled as TMED3.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223175 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/2500. Predicted molecular weight: 25 kDa. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. -
Sequence similarities
Belongs to the EMP24/GP25L family.
Contains 1 GOLD domain. -
Cellular localization
Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Golgi apparatus > Golgi stack membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. Probably cycles between compartments of the early secretatory pathway. - Information by UniProt
-
Database links
- Entrez Gene: 23423 Human
- SwissProt: Q9Y3Q3 Human
- Unigene: 513058 Human
-
Alternative names
- C15orf22 antibody
- Integral type I protein antibody
- Membrane protein p24B antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-p26 antibody (ab223175)PFA-fixed, Triton X-100 permeabilized BJ cells stained for p26 (green) using ab223175 at 4 µg/ml in ICC/IF.
-
Western blot - Anti-p26 antibody (ab223175)All lanes : Anti-p26 antibody (ab223175) at 1/1000 dilution
Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
Predicted band size: 25 kDa
Datasheets and documents
References
ab223175 has not yet been referenced specifically in any publications.
