Overview

  • Product name

  • Description

    Rabbit polyclonal to P2X4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human P2X4 aa 359-388.
    Sequence:

    YCMKKRLYYREKKYKYVEDYEQGLASELDQ


    Database link: Q99571

  • Positive control

    • IHC-P: Human placenta, cerebral cortex and small intestine tissue. WB: SK-MEL-30 cell lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 43 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin.
  • Sequence similarities

    Belongs to the P2X receptor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI504491 antibody
    • ATP gated cation channel protein antibody
    • ATP receptor antibody
    • AW555605 antibody
    • D5Ertd444e antibody
    • fi03f02 antibody
    • MGC143034 antibody
    • OTTMUSP00000023741 antibody
    • OTTMUSP00000023745 antibody
    • OTTMUSP00000023746 antibody
    • OTTMUSP00000023747 antibody
    • P2rx4 antibody
    • P2RX4_HUMAN antibody
    • P2X purinoceptor 4 antibody
    • P2X receptor subunit 4 antibody
    • P2X4 antibody
    • P2X4R antibody
    • Purinergic receptor antibody
    • Purinergic receptor P2X ligand gated ion channel 4 antibody
    • Purinergic receptor P2X4 antibody
    • Purinoceptor P2X4 antibody
    • wu:fi03f02 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling P2X4 using ab243734 at 4 µg/ml (green) in ICC/IF.

  • Anti-P2X4 antibody (ab243734) at 0.4 µg/ml + SK-MEL-30 cell lysate

    Predicted band size: 43 kDa

  • Formalin-fixed, paraffin-embedded human small intestine tissue stained for P2X4 with ab243734 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for P2X4 with ab243734 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for P2X4 with ab243734 at a 1/50 dilution in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for P2X4 with ab243734 at a 1/50 dilution in immunohistochemical analysis. No membranous positivity in myocytes, as expected.

References

ab243734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up