Overview

  • Product name

  • Description

    Rabbit polyclonal to P2X7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Synthetic peptide within Human P2X7 aa 21-70 (N terminal). The exact sequence is proprietary.
    Sequence:

    IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE


    Database link: Q99572

  • Positive control

    • Jurkat cell lysate; Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab48871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 31 kDa (predicted molecular weight: 31 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500

Target

  • Function

    Receptor for ATP that acts as a ligand-gated ion channel. Responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Could function in both fast synaptic transmission and the ATP-mediated lysis of antigen-presenting cells.
  • Tissue specificity

    Widely expressed with highest levels in brain and immune tissues.
  • Sequence similarities

    Belongs to the P2X receptor family.
  • Post-translational
    modifications

    Phosphorylation results in its inactivation.
    ADP-ribosylation at Arg-125 is necessary and sufficient to activate P2RX7 and gate the channel.
    Palmitoylation of several cysteines in the C-terminal cytoplasmic tail is required for efficient localization to cell surface.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ATP receptor antibody
    • P2rx7 antibody
    • P2RX7_HUMAN antibody
    • P2X purinoceptor 7 antibody
    • P2X7 antibody
    • P2Z receptor antibody
    • Purinergic receptor antibody
    • purinergic receptor P2X, ligand gated ion channel, 7 antibody
    see all

Images

  • Anti-P2X7 antibody (ab48871) at 1.25 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 31 kDa
    Observed band size: 31 kDa



    Antibody diluted in 5% skim milk / PBS buffer; Gel concentration 12%
  • Ab48871 at 4.0µg/ml staining paraffin embedded human kidney. Magnification x400. Arrows indicate staining of epithelial cells of renal tubule.

References

This product has been referenced in:

  • Xu XY  et al. Role of the P2X7 receptor in inflammation-mediated changes in the osteogenesis of periodontal ligament stem cells. Cell Death Dis 10:20 (2019). Read more (PubMed: 30622236) »
  • Cui BW  et al. Thymoquinone Attenuates Acetaminophen Overdose-Induced Acute Liver Injury and Inflammation Via Regulation of JNK and AMPK Signaling Pathway. Am J Chin Med 47:577-594 (2019). Read more (PubMed: 30974967) »
See all 7 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Mouse Tissue lysate - whole (Liver and Brain)
Gel Running Conditions
Non-reduced Denaturing (12% gel)
Loading amount
30 µg
Treatment
24hrs after CLP (Cecal Ligation and Puncture)
Specification
Liver and Brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Dr. Zhenyu Wu

Verified customer

Submitted Nov 07 2018

Answer

Thank you for your enquiry from our Live Support service this morning. I have reviewed the details for ab48871 P2RX7 antibody. From the SwissProt protein database entries on the datasheet, the P2RX7 protein appears to have several isoforms. The isoforms in the following Swissprot links are at around 31 - 35 KDa. It is therefore very likely the antibody is detecting one of these isoforms in the image provided on the datasheet and this will explain the results. 31 kDa isoform Swissprot entry http://www.expasy.org/cgi-bin/niceprot.pl?Q4VKH9 35 kDa isoform F Swissprot entry http://www.expasy.org/cgi-bin/niceprot.pl?Q4VKI0 31 kDa Isoform E 31 http://www.expasy.org/cgi-bin/niceprot.pl?Q4VKI1 I hope this is helpful to you. Should you have any further quesitons, please do not hesitate to contact us.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up